KEGG   Rhodothermus marinus DSM 4252: Rmar_1690Help
Entry
Rmar_1690         CDS       T01119                                 

Definition
(GenBank) ROK family protein
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
rmr  Rhodothermus marinus DSM 4252
Pathway
rmr00010  Glycolysis / Gluconeogenesis
rmr00052  Galactose metabolism
rmr00500  Starch and sucrose metabolism
rmr00520  Amino sugar and nucleotide sugar metabolism
rmr00521  Streptomycin biosynthesis
rmr01100  Metabolic pathways
rmr01110  Biosynthesis of secondary metabolites
rmr01120  Microbial metabolism in diverse environments
rmr01130  Biosynthesis of antibiotics
rmr01200  Carbon metabolism
Module
rmr_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:rmr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Rmar_1690
   00052 Galactose metabolism
    Rmar_1690
   00500 Starch and sucrose metabolism
    Rmar_1690
   00520 Amino sugar and nucleotide sugar metabolism
    Rmar_1690
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Rmar_1690
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    Rmar_1690
Enzymes [BR:rmr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Rmar_1690
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK BcrAD_BadFG FGGY_N Hydant_A_N
Motif
Other DBs
NCBI-ProteinID: ACY48576
UniProt: D0MJB8
Position
1954238..1955236
Genome map
AA seq 332 aa AA seqDB search
MASIPSFAVGVDLGGTTIKAALVERGVGIQHELSRPTEAEEGPAHVIRRIAEMVQALIER
APNREIAGIGIGAPGTVNWERTAVIYPPNLPGWGIVDLRKELQEALGLALPIFVENDANL
AGLGSAHYGAGRPFDSFIMVTLGTGVGGAIIYRNRIFRGATGGAGEIGHMSIDYEGPLDR
YGIAGSIEAYIGQRFLSHYARYRLLTQRDSLVHQMAGEDLRDINPRILFEAAQAGDEPAR
EVLAWAGHKLGCVLAAAVNLLDIHKIVVGGGVSAAGDFILEPARQTLRRYVIPALRDRVE
IVRETLGNEAGMLGAAQLVFQLLEHPREDLEA
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atggcttccattccgtcttttgccgttggcgtcgatctgggaggaaccaccatcaaggcc
gccctggtggagcgcggcgtgggcatccagcacgaactgagccgccccaccgaggccgaa
gaaggaccggcgcacgtcattcgccggatcgccgagatggtgcaggcactcatcgaacgt
gcccccaaccgggagattgcgggcatcggcatcggcgcgccgggaaccgtcaactgggaa
cgcaccgccgtcatctatccacccaacctgcccggctggggcatcgtcgatctgcggaag
gaactgcaggaagcactgggcctcgcgctgccgatcttcgtcgagaacgacgcgaacctg
gccggactgggctcggcgcactacggggccggccgaccgttcgactcgttcatcatggtc
acgctgggcaccggcgtgggcggggccatcatctatcggaaccgtatttttcgaggcgct
acgggcggtgccggcgaaatcggccacatgagcatcgactacgaagggccgctcgaccgc
tacggcatcgccggctccatcgaggcctacatcggccagcgttttctctcacactacgcc
cgctatcggctgctcacgcaacgggacagcctcgtgcatcagatggccggcgaggacctg
cgcgacatcaatccgcgcattctcttcgaggccgcacaggccggcgacgaaccggcccgc
gaggtgctggcctgggccggacacaagctgggttgcgtgctggcggcggccgtcaacctg
ctcgacatccataagatcgtagtgggcggtggcgtatcggccgcgggcgacttcatcctg
gagccggcccgccagacgcttcgccgctacgtgatccccgccctgcgtgaccgcgtggaa
atcgtccgcgaaacgctgggtaacgaggccggtatgctgggcgccgcgcaactggtcttt
caacttctggaacatccccgcgaagacctggaagcctga

DBGET integrated database retrieval system