KEGG   Rhodothermus marinus DSM 4252: Rmar_1694Help
Entry
Rmar_1694         CDS       T01119                                 

Definition
(RefSeq) succinyl-CoA synthetase subunit beta
  KO
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
rmr  Rhodothermus marinus DSM 4252
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:rmr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Rmar_1694
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Rmar_1694
   00640 Propanoate metabolism
    Rmar_1694
   00660 C5-Branched dibasic acid metabolism
    Rmar_1694
Enzymes [BR:rmr01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Rmar_1694
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1958807..1959994)
Genome map
AA seq 395 aa AA seqDB search
MKLHEYQAKDILQRYGVATQPGYVARTVEEAVEAARRLQQEHGYELFVVKAQIHAGGRGK
GGGVKLAKGIEEVREKAGAILGMNLVTPQTGPEGQKVRAVLVAGAVDIAKEYYLGITLDR
QRSQNVIMASTEGGVEIEEVAARSPEKILKVWVDPTIGLRPFQARQLAFGLGFEGNAFKQ
AVQFIQALYRAYEETDSSLAEINPLVLTKQGDVVAVDAKINLDDNALFRHPDLAELRDIH
EEDPLEVEASKYRLNYVRLTGNVGCMVNGAGLAMATMDLIKLAGGEPANFLDVGGGASPE
TVEAGFRIILKDPNVKVILVNIFGGIVRCDRVARGIVEAARKVQINVPLIVRLQGTNAEE
ARAILEQSGLEIETATLFKEVADKVNQALQRVAAA
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atgaaactgcacgagtatcaggccaaggatattctgcaacgctatggcgtggccacgcag
cccggttatgtggcccgcaccgtggaggaagcggtcgaagccgcccgtcgcctgcagcag
gagcacgggtatgagctgttcgtggtgaaggcgcagattcacgccggcggtcgcggcaag
ggcgggggcgtcaagctggcgaagggcatcgaggaagtgcgcgagaaggccggcgccatt
ctgggcatgaacctggtcacgccccagacgggccccgagggacagaaagtgcgggccgtg
ctggtggccggcgccgtcgatattgcgaaggaatactatctgggcattacgctggaccgc
cagcggagccagaacgtgatcatggcctcgacggaagggggcgtggagatcgaggaagtg
gccgcccggagtcccgagaagatcctgaaggtgtgggtcgatcctaccatcggcctgcgt
ccattccaggcacgacagctggccttcgggctgggcttcgagggcaacgccttcaagcag
gccgtccagttcatccaggcgctctatcgggcctacgaagaaaccgacagctcgctggcc
gagatcaacccgcttgtgctgacgaagcagggcgacgtggtggccgtcgacgccaagatc
aacctggacgacaacgcgcttttccggcatcccgatctggccgagctccgcgacatccac
gaggaagacccgctggaggtcgaggccagcaagtaccggctcaactacgtgcggctcacc
ggcaacgtgggctgcatggtgaacggagccggcctggccatggccacgatggacctgatc
aagctggcgggcggcgagccggccaacttcctggatgtgggcggtggggccagcccggag
accgtggaggccggcttccgcatcatcctgaaggacccgaacgtcaaggtgattctggtg
aatatcttcggtggcatcgtgcgctgcgaccgcgtcgcccgcggcatcgtcgaagcggcc
cggaaggttcagatcaacgtgccgctgatcgtgcggctgcagggcaccaacgccgaagaa
gcgcgtgccattctggagcagagtggcctggagatcgagacggccacgctcttcaaagag
gtggccgacaaggtgaaccaggcgctgcagcgcgtcgccgcagcctga

DBGET integrated database retrieval system