KEGG   Rhodothermus marinus DSM 4252: Rmar_1886Help
Entry
Rmar_1886         CDS       T01119                                 

Definition
1,4-alpha-glucan branching protein
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
rmr  Rhodothermus marinus DSM 4252
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Trehalose biosynthesis, D-glucose 1P => trehalose
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:rmr00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2206704..2208569
Genome map
AA seq 621 aa AA seqDB search
MSWLTEEDIRRWESGTFYDSYRKLGAHPDDEGTWFCVWAPHADGVSVLGAFNDWNPEANP
LERYGGGLWAGYVPGARPGHTYKYRIRHGFYQADKTDPYAFAMEPPTGSPIEGLASIITR
LDYTWHDDEWMQRRKGPASLYEPVSIYEVHLGSWRHKRPGESFSYREIAEPLADYVQEMG
FTHVELLPVMEHPYYGSWGYQVVGYYAPTFRYGSPQDLMYLIDYLHQRGIGVLLDWVPSH
FAADPQGLVFFDGTTLFEYDDPKMRYHPDWGTYVFDYNKPGVRNFLISNALFWLEKYHVD
GLRVDAVASMLYRDYSRKEWTPNIFGGRENLEAIDFIKRFNETVYLHFPEAMTIAEESTA
WPGVSAPTYNNGLGFLYKWNMGWMHDTLDYIRRDPIYRKYHHDELTFSLWYAFSEHYVLP
LSHDEVVHGKGSLWGKMPGDDWQKAANLRLLFGHMWGHPGKKLLFMGGEFGQHHEWNHDT
QLEWHLLDQPYHRGIQLWVRDLNHLYRTNPALWHDGPEGFEWIDFSDRDQSVICYLRRNA
GRMLLFVLNFTPVPREHYRVGVPIGGPWREVLNSDAVAYGGSGMGNLGRVEAVPESWHGR
PFHLELTLPPLAALILEPEHG
NT seq 1866 nt NT seq  +upstreamnt  +downstreamnt
atgagctggctcacggaagaagacatccggcgctgggaaagcggcacattctacgacagc
taccggaagctgggcgcccatcccgacgacgaaggcacctggttctgcgtctgggcgccg
catgccgacggtgtctcggtgctcggcgccttcaacgactggaatccggaggccaacccg
ctggagcgctacggcggcggcctgtgggccggctacgtaccgggagcgcgcccgggccat
acgtacaagtaccggatccggcacggcttctaccaggccgacaagacggacccctacgcc
ttcgccatggagccgcccaccggcagccccatcgaagggctggcctccatcatcacgcgg
ctcgactacacctggcacgacgacgaatggatgcagcgccgtaaaggtccggccagcctc
tacgagccggtttccatctacgaggtccatctgggctcctggcgccacaaacgacccggc
gagtctttctcctaccgggagattgccgagccgctggccgactacgtgcaggagatgggc
ttcacgcatgtggagctgctgcccgtcatggaacatccctactacggttcctggggctat
caggtggtcggctactacgccccgacgtttcgctacggctcgcctcaggacctgatgtac
ctgatcgactacctgcaccagcgcggcatcggcgtccttctcgactgggtcccgagccac
tttgcagccgatccccagggcctggttttcttcgacgggaccacgctcttcgaatacgac
gatcccaagatgcgctatcaccccgactggggcacctacgtgttcgactacaacaaaccg
ggcgtgcgcaattttctgatctccaacgcgctgttctggctcgaaaagtaccacgtcgac
gggctgcgcgtcgatgcggtggcctccatgctctaccgggactactcacgtaaggagtgg
acgcccaacatcttcggcggccgcgaaaacctggaagccattgatttcatcaagcgattc
aacgagacggtctacctgcacttccccgaggccatgacgatcgccgaggaatcgacggcc
tggcccggcgtgtcggcccccacctacaacaacgggctgggctttctctacaagtggaac
atgggctggatgcacgacacgctggactacatccggcgcgaccccatctatcgcaagtat
caccacgacgagctgaccttctcgctctggtacgccttttcggagcattacgtcctgccg
ctctcccacgacgaggtggtgcacggcaagggctcgctctggggcaaaatgcccggcgac
gactggcagaaagcggccaatctgcgcctgctctttggtcacatgtggggccatccgggt
aaaaaactgctcttcatgggcggtgaattcggccagcaccatgaatggaaccacgatacg
cagctcgaatggcacctgctggaccagccctaccatcggggcattcagctatgggtgcgc
gatctgaaccacctctaccgtacgaatccggccctctggcacgacggaccggaagggttc
gagtggatcgacttcagcgaccgtgaccagagcgtgatctgctacctgcgtaggaatgcc
ggccgcatgctgctgttcgtactgaacttcacgcctgtgccacgtgagcactaccgcgtg
ggcgtgccgatcggcggcccctggcgcgaggtgctcaacagcgacgcggtggcctacggc
ggaagcggaatgggcaacttgggccgcgtcgaggcggtgcccgagtcctggcacggccgc
cccttccacttagagctgacgcttcccccgctggccgccctcatcctggagccggaacac
gggtag

DBGET integrated database retrieval system