KEGG   Rhodothermus marinus DSM 4252: Rmar_1941Help
Entry
Rmar_1941         CDS       T01119                                 

Definition
glycoside hydrolase
Orthology
K01190  
beta-galactosidase [EC:3.2.1.23]
Organism
rmr  Rhodothermus marinus DSM 4252
Pathway
Galactose metabolism
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rmr00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Rmar_1941
  Lipid metabolism
   00600 Sphingolipid metabolism
    Rmar_1941
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    Rmar_1941
Enzymes [BR:rmr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     Rmar_1941
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2266979..2269690)
Genome map
AA seq 903 aa AA seqDB search
MRISGSRYRMFLGGGLLLLLTILPLQAQPAQELLRERVLLNEDWRFFKYPSRAEADGLVY
DVWPMYRMDADTAGAPKEAIVLKPWILPTGNPFIKDPARRYRRPPGHPGRDFPFVQPDFD
DSGWERVDLPHDWAIRGPFVEQPHPEVDGGMGWLPSPGVAWYRKKIFIPAADSERAIYLD
VEGAMAHAVVWLNGYLVGGWPYGYASWRVDLTPYVRWGAENQLAIRLEVLPRSSRWYPGG
GLYRNVWLVKTHPVHVAQWGTFVRTPYVSTDSATVVLDVTIENRWARAVSVRVTTEIFEL
GEEDRPRGDAVAAFPPRQVRVPAQGQATASGMATVRNPKLWGPPPTQTPHRYVAVTTLWL
DGRPVDRYETRFGIRSLRFDPERGLLVNGERIEIKGVNQHHDLGPLGAAFNRRAAERQLE
LLREMGANAIRTAHNPPAPELLELTDRMGFLVLDEIFDVWEMRKTPLDFHLIFPDWHEQD
LRAFIRRDRNHPSVILWSFGNEVGEQGSGREGAELARRLARIIKEEDPTRPVTASMNFAR
PGTPMPEVVDVICLNYQGEGIRDMPAYTGLQGITTPPLYSAFRIHFPTKMIISCENAAAV
SSRGAYLFPVTDALSAPVREGQGGDPVTRQVSGYELYTADFGSSVDKVFFVQELHPFVAG
GFVWSGWDYLGEPTPYYSSRSSYFGIIDLAGFKKDRFYLYQARWRPELPMVHILPHWNWP
DRVGEITPVHVFTSGDEVELFLNGRSLGRKKKGPYQYRLRWDDVRYEPGELRAVAYKNGR
KWAEAVVQTTGQPTALAAEADRVRIQADGYDLAFITVRVVDAEGRTVPTADNPVRFTVEG
PGELVATANGDPTSFIPFSSDERPAFNGLVLAIVRARRGMPGTITVTASAPGLRPARIVI
ESQ
NT seq 2712 nt NT seq  +upstreamnt  +downstreamnt
atgcgcatctccggttctcgctatcggatgtttttaggaggcgggctgctcctgctgctg
acgatcctgccattgcaggcacaacccgcgcaggagctgctgcgcgagcgggttttgctt
aatgaagactggcgcttcttcaagtacccctcccgggcggaagccgacggactggtctac
gacgtgtggccgatgtaccggatggatgcagacaccgccggagcaccgaaggaggcgatc
gtccttaagccctggattctgcccacgggcaatcctttcatcaaagatccggcccgacgt
tacaggcgacccccgggacatcccgggcgtgacttcccgttcgtgcagccggacttcgac
gatagcggctgggaacgagtagacctgccgcacgactgggccattcggggccccttcgtg
gaacaaccacatcccgaggtggacggcggcatgggctggctgcccagcccgggcgtggcc
tggtaccggaagaaaatcttcatcccggccgccgattcggagcgggcgatctacctggac
gtcgagggcgcgatggctcacgccgtcgtctggctgaacggctacctggtgggtggctgg
ccctacggctacgcttcctggcgcgtggatctgaccccatacgtccgctggggcgcggaa
aaccagcttgccatccgacttgaggtgcttccacgctcgtcgcgctggtatcccggcggt
ggattgtaccgcaacgtctggctggtcaagacgcatccggtgcacgtggcgcaatggggc
acgttcgtgcgcacaccctacgtctcgaccgactcggccaccgttgtgctggatgtgacc
atcgaaaaccgatgggcccgggccgtctcggtgcgcgttacgacagagatcttcgagctg
ggcgaagaggaccggccacggggcgatgccgtcgccgcgttcccgccccggcaggtgcgg
gtaccggcgcaggggcaggctacggcgtccggcatggcgacggttcgcaacccgaagctg
tggggacctccgcccacgcagacgcctcaccgctacgtggccgtcaccacgctgtggctc
gacggccgcccggtcgatcgctacgaaacccgcttcggcatccgctcgctgcggttcgat
ccggagcgcgggctgctggtcaacggcgagcgcatcgaaatcaaaggcgttaaccagcat
cacgacctggggccgctgggcgcggccttcaaccgaagggcggccgagcgccagctcgaa
ctgctgcgtgagatgggcgccaacgccattcgtaccgcccataacccgccagctcccgag
ctgctggagcttaccgaccgcatgggcttcctcgtgctcgacgagatcttcgacgtctgg
gagatgcgaaaaaccccgctcgacttccacctgatctttccggactggcacgagcaggac
ctgcgcgcctttatccgccgcgaccgcaaccacccgtcggtcattctctggagcttcggc
aatgaagtgggcgagcagggaagcggccgcgagggggccgagctggcccggcgactggcc
cgcatcatcaaagaggaggatcccacgcggccggtgacggcgtctatgaatttcgcccgg
ccggggacgccgatgcccgaggtggtggacgtcatctgcctgaactatcagggtgaaggg
atccgggacatgccggcctatactggtttgcaggggatcaccacaccacccctttacagc
gcatttcgcatacatttccctacaaaaatgattatcagttgtgaaaatgcggccgctgta
agttcgcggggcgcctatctctttccagttacagatgccctgagtgcacctgttcgtgaa
ggccaggggggtgatccggttaccaggcaggtaagcggctatgagctatatacggcggat
tttggctcttcggtggacaaggtgtttttcgtgcaggaactccatccttttgtggccggc
ggtttcgtctggagcggctgggactatctgggcgagcccacgccctactacagttcgcgc
agctcttatttcgggatcatcgatctggccggtttcaaaaaggatcggttttacctgtat
caggcccgctggcgtcccgagctaccgatggtgcatatcctgccccactggaactggccg
gatcgcgtgggggagatcacgcccgtgcatgtgttcacctcgggcgacgaggtggaactg
ttcctcaatggccgatcgctcggccgcaagaaaaaagggccctaccagtaccgcctgcgc
tgggacgacgtgcgctacgagcccggcgaactacgcgccgtggcctataaaaacggccgg
aagtgggccgaagccgtcgtgcagaccaccggccagccgaccgcgctggccgccgaggcg
gaccgtgtccggatccaggccgacggctacgacctggcattcatcacggtgcgggtggtc
gatgcagaagggcgaaccgtgcccacggcggacaatccggtgcgtttcaccgtcgaagga
cccggcgagctggtggccacggccaacggcgacccgaccagcttcattccgttttcttcg
gatgagcggccggccttcaacgggctggtgctggccatcgtgcgcgcccggcgtggcatg
cccggcactattaccgtcacggccagcgcccccggtctgcgtccggctcgtatcgtgata
gaaagccagtga

DBGET integrated database retrieval system