KEGG   Rhodothermus marinus DSM 4252: Rmar_2012Help
Entry
Rmar_2012         CDS       T01119                                 

Definition
nitrous-oxide reductase (EC:1.7.2.4)
Orthology
K00376  
nitrous-oxide reductase [EC:1.7.2.4]
Organism
rmr  Rhodothermus marinus DSM 4252
Pathway
Nitrogen metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:rmr00001]
 Metabolism
  Energy metabolism
   00910 Nitrogen metabolism
    Rmar_2012
Enzymes [BR:rmr01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.2  With a cytochrome as acceptor
    1.7.2.4  nitrous-oxide reductase
     Rmar_2012
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2342328..2344319
Genome map
AA seq 663 aa AA seqDB search
MKRHTLRGLTGLALVALLLIGLIGCQGGGQTGAVVSEDPMEIARARGLSPADVVAAVKTY
QPTGTYDEYIMFASGGHSGQVLVIGIPSMRLLKVIGVFTPEPWQGWGFSKETKEVLAQGN
YDGKELTWGDVHHPALSETNGDYDGQFLFVNEKANSRVAVIDLRDFETKQIVKNPLSLSD
HGGTFVTPNTEWVIEGGQYAAPFEGYAPLDQYKEKYRGLVTFWKFDRERGRIIPEQSFAL
ELPPYWQDLCDAGKQVSEGWVFCNSFNTEMATGGVEKGNPPFEAGASQRDMDYLHLINLR
KAAELVEAGRTRTIKGFKVLPLDVAAAEGVLYFVPEPKSPHGVDVSPDGNYLVVSGKLDP
HATIYNFQKIQDAIANERFSGRDDYGVPILDFDAVVETQIELGLGPLHTQFDPNGYAYTS
LFLESAVVRWTLGGPWAEKHGRDPWTVVDKVSVHYNIGHLAVAEGDNVNPDGRYLVAMNK
WSVDRFANVGPLLPQNFQLVDIGNPNGPMQLLYDMPIALGEPHYAQIIKADKLQPWEVYP
EVGWDPTTQSRHPAATRPGEERIERRGNTVEIWMTATRSHFTPEHVEVRKGDRVIWHITN
IERARDATHGFALPGYNFNLSIEPGETATIEFVADRDGVFAFYCTEFCSALHLEMAGYFL
VRP
NT seq 1992 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgccacacgttacgcgggctgaccggtctggcgctggtcgccctgctgctgatc
ggcttgatcggttgtcagggcggcggacagacaggcgccgtggtcagcgaagaccccatg
gagatcgcacgggcgcgtgggctgagcccggccgatgtggtggccgcggtgaaaacctac
cagcccaccggcacctacgacgagtacatcatgttcgcctcgggcggacattccggacag
gtgctcgtcatcggtattccgtcgatgcgcctgctgaaggtgatcggcgtcttcacgccg
gaaccctggcagggctggggtttctcgaaggaaaccaaggaagtgctcgcccagggtaac
tacgacggcaaggagctgacctggggcgacgtgcaccacccggccctctccgagacgaac
ggcgactacgacgggcaattcctgttcgtcaacgaaaaggccaactcgcgcgtggccgtc
atcgacctgcgggacttcgagacgaagcagatcgtcaagaacccgttgtcgctcagcgac
cacggcggcacgttcgtcacgcccaatacggagtgggtgatcgaaggcggccagtatgcc
gccccgttcgagggctacgcgcccctggatcagtacaaggagaagtaccgtggcctggtc
accttctggaagttcgaccgcgagcggggacggatcattcccgagcagtccttcgcgctg
gagctgcccccctactggcaggacctgtgcgacgccggcaagcaggtgagcgaagggtgg
gtcttctgcaactcgttcaacacggagatggccaccggtggcgtggagaaaggcaacccg
cccttcgaggccggcgcctcgcagcgcgacatggactacctgcacctgatcaacctgcgc
aaggcggctgagctggtcgaggccggtcgcacgcgcacgatcaagggcttcaaggtcctg
ccgctggatgtggcggccgccgagggtgtgctctacttcgtgcccgaacccaagagcccg
catggcgtcgacgtttcgccggacggcaactacctggtcgtctccggcaagctcgatccg
cacgccaccatctacaacttccagaagatccaggacgccatcgccaacgagcgcttctcc
gggcgtgacgactacggcgtgccgatcctggacttcgacgcggtggtcgaaacccagatt
gaactggggctcgggccgctgcacacgcagttcgacccgaacggctacgcctacacgagc
ctcttcctggaaagcgccgtggtgcgctggacgctgggcggtccctgggccgaaaagcac
ggccgggatccgtggaccgtggtcgacaaggtgtcggtccactacaacatcgggcacctg
gccgtggccgaaggcgacaacgtgaaccccgacggccgctacctggtggccatgaacaag
tggtccgtggaccgcttcgcaaacgtggggccgctgctgccgcagaacttccagcttgtc
gacatcggcaacccgaacggcccgatgcagctcctctacgacatgcccattgcgctgggt
gagccgcactatgcccagatcattaaggcggacaaactccagccgtgggaggtctatccg
gaggtgggctgggatccgaccacccagtcgcggcatccggcggccacccgtccgggtgag
gagcgcatcgaacgtcggggcaacaccgtggagatctggatgacggccacacggagccac
ttcacgccggagcatgtggaggtccgcaagggcgaccgcgtgatctggcacattacgaac
atcgagcgggcgcgggacgccacgcacggctttgcactgcccggctataacttcaacctg
agcatcgaaccgggcgagacggccaccatcgagttcgtggccgaccgcgacggcgtcttc
gccttctactgcaccgagttctgctcggccctccacctggagatggccggctacttcctg
gtgcgtccataa

DBGET integrated database retrieval system