KEGG   Rhodothermus marinus DSM 4252: Rmar_2051Help
Entry
Rmar_2051         CDS       T01119                                 

Definition
(GenBank) ribulose-phosphate 3-epimerase
  KO
K01783  ribulose-phosphate 3-epimerase [EC:5.1.3.1]
Organism
rmr  Rhodothermus marinus DSM 4252
Pathway
rmr00030  Pentose phosphate pathway
rmr00040  Pentose and glucuronate interconversions
rmr01100  Metabolic pathways
rmr01110  Biosynthesis of secondary metabolites
rmr01120  Microbial metabolism in diverse environments
rmr01130  Biosynthesis of antibiotics
rmr01200  Carbon metabolism
rmr01230  Biosynthesis of amino acids
Module
rmr_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
rmr_M00007  Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
Brite
KEGG Orthology (KO) [BR:rmr00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Rmar_2051
   00040 Pentose and glucuronate interconversions
    Rmar_2051
Enzymes [BR:rmr01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.1  ribulose-phosphate 3-epimerase
     Rmar_2051
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribul_P_3_epim QRPTase_C TMP-TENI Aldolase
Motif
Other DBs
NCBI-ProteinID: ACY48932
UniProt: D0MD20
Position
2386506..2387180
Genome map
AA seq 224 aa AA seqDB search
MVILAPSILSADFARLGEQCREALEAGADWIHIDVMDGHFVPNITMGPLVVEALRPLADE
LGAVLDVHLMVERPERFLEDFARAGADNLTVHVEATPHLHRALDEIRRLGKKVGVALNPA
TPLSALEEVLPLVDLILVMTVDPGFGGQDYIPSSTLKVQRLRRLLNAIGSHAYIEVDGGI
YPHNVAEVVRAGATVIVAGSAIFNRHAPVAQNVAAFRQALLLEA
NT seq 675 nt NT seq  +upstreamnt  +downstreamnt
atggtgatcctggcgccctccatcctgtcggccgattttgcccggctgggcgagcaatgc
cgggaagcgctggaggccggcgccgactggatccatatcgacgtgatggacggccacttc
gtgccgaacatcacgatggggccgctggtggtcgaggcgctccgcccgctggccgatgag
ctgggtgccgtgctcgacgtgcacctgatggtggagcggcccgagcgctttctggaagac
ttcgcccgcgccggggccgacaacctgaccgtccacgtggaggccacgccacatctgcac
cgggcgctggacgagatccgccgcctcggcaaaaaagtcggcgtggcgctcaatccggcc
acgcccctttcggccctggaagaagtgctgccgctggtcgatctgattctggtgatgacc
gtcgatccgggcttcggcggtcaggactacattccctccagcacgctgaaggtgcagcgc
ctgcgccggctgctgaacgccatcggctcgcatgcctatatcgaagtggacggcgggatc
tatccgcacaacgtggccgaagtggtgcgggccggcgccacggtgatcgtggccggaagc
gccatcttcaaccgccacgcgcccgtcgcccagaacgtggcggccttccgccaggcgttg
ctgctggaggcctga

DBGET integrated database retrieval system