KEGG   Rhodothermus marinus DSM 4252: Rmar_2051Help
Entry
Rmar_2051         CDS       T01119                                 

Definition
ribulose-phosphate 3-epimerase
Orthology
K01783  
ribulose-phosphate 3-epimerase [EC:5.1.3.1]
Organism
rmr  Rhodothermus marinus DSM 4252
Pathway
Pentose phosphate pathway
Pentose and glucuronate interconversions
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Pentose phosphate pathway (Pentose phosphate cycle)
Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
Brite
KEGG Orthology (KO) [BR:rmr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Rmar_2051
   01230 Biosynthesis of amino acids
    Rmar_2051
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Rmar_2051
   00040 Pentose and glucuronate interconversions
    Rmar_2051
Enzymes [BR:rmr01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.1  ribulose-phosphate 3-epimerase
     Rmar_2051
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2386506..2387180
Genome map
AA seq 224 aa AA seqDB search
MVILAPSILSADFARLGEQCREALEAGADWIHIDVMDGHFVPNITMGPLVVEALRPLADE
LGAVLDVHLMVERPERFLEDFARAGADNLTVHVEATPHLHRALDEIRRLGKKVGVALNPA
TPLSALEEVLPLVDLILVMTVDPGFGGQDYIPSSTLKVQRLRRLLNAIGSHAYIEVDGGI
YPHNVAEVVRAGATVIVAGSAIFNRHAPVAQNVAAFRQALLLEA
NT seq 675 nt NT seq  +upstreamnt  +downstreamnt
atggtgatcctggcgccctccatcctgtcggccgattttgcccggctgggcgagcaatgc
cgggaagcgctggaggccggcgccgactggatccatatcgacgtgatggacggccacttc
gtgccgaacatcacgatggggccgctggtggtcgaggcgctccgcccgctggccgatgag
ctgggtgccgtgctcgacgtgcacctgatggtggagcggcccgagcgctttctggaagac
ttcgcccgcgccggggccgacaacctgaccgtccacgtggaggccacgccacatctgcac
cgggcgctggacgagatccgccgcctcggcaaaaaagtcggcgtggcgctcaatccggcc
acgcccctttcggccctggaagaagtgctgccgctggtcgatctgattctggtgatgacc
gtcgatccgggcttcggcggtcaggactacattccctccagcacgctgaaggtgcagcgc
ctgcgccggctgctgaacgccatcggctcgcatgcctatatcgaagtggacggcgggatc
tatccgcacaacgtggccgaagtggtgcgggccggcgccacggtgatcgtggccggaagc
gccatcttcaaccgccacgcgcccgtcgcccagaacgtggcggccttccgccaggcgttg
ctgctggaggcctga

DBGET integrated database retrieval system