KEGG   Rhodothermus marinus DSM 4252: Rmar_2163Help
Entry
Rmar_2163         CDS       T01119                                 

Definition
(RefSeq) malate synthase A
  KO
K01638  
malate synthase [EC:2.3.3.9]
Organism
rmr  Rhodothermus marinus DSM 4252
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:rmr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Rmar_2163
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Rmar_2163
   00630 Glyoxylate and dicarboxylate metabolism
    Rmar_2163
Enzymes [BR:rmr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     Rmar_2163
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2517743..2519329)
Genome map
AA seq 528 aa AA seqDB search
MQGIEIRGARLPEAEQVLTPEALDFVAGLHREFNAVRKGLLARRAEIWARLLEGERPDFL
PHTRHIREGDWKVAPCPDDLQDRRVEITGPVDRKMMINALNSGARVFMADFEDALSPTWE
NVVRGQKNLIDAVRRTLEYTSPEGKEYRLGEKLATLLVRPRGWHLEERHVWIDGEPVSAS
LFDFGLYFFHNARELLERGSGPYFYLPKLESHLEARLWNEVFNFAQDYLGIPRGTIRATV
LIETILAALEMEEILYELRDHAAGLNAGRWDYIFSCIKKFHATAPIFPDRAQVTMTVPFM
YAYTELLVKTCHRRGAHAIGGMAAFIPSRRDPAVNERALAEVRKDKEREAGQGFDGTWVA
HPDLVPVAEEVFDRYLGDRPHQKDRLREDVQVTADDLLDFRVPGGRITEGGLRNNVSVAL
QYLNQWFSGNGAAAIFNLMEDAATAEIARAQLWQWVHREARLDDGRPITPELYAQVREEE
LAKLGGRDTAHYREAAEVLDYLVLSDSFIEFLTFPAYERLLQLEMVPG
NT seq 1587 nt NT seq  +upstreamnt  +downstreamnt
atgcaaggcattgagattcgaggcgcgcggctgcccgaagccgaacaggtgctgactcct
gaagcgctggacttcgtggccggactgcaccgtgagttcaatgcggtgcgtaagggattg
ctggcccgccgcgcggagatctgggcacggctgctcgaaggagaacgccccgattttctg
ccgcacacgcggcacatccgcgagggcgactggaaggtggcgccctgtccggacgatctg
caggatcggcgtgtggagatcaccgggccggtagatcgcaagatgatgatcaacgcgctg
aactccggggcacgggtcttcatggccgacttcgaggacgcgctctcgcccacctgggaa
aacgtggtgcgcggtcagaagaacctgatcgacgccgtacgccgcacgctggagtacacc
tcgccggaagggaaggaataccggctgggggagaagctggccacgctgctggtgcggccg
cgtgggtggcatctggaagagcggcacgtctggatcgacggcgagcccgtcagcgcctca
ctgttcgactttggcctgtacttcttccacaatgcccgagaactcctggagcggggaagt
ggaccgtatttctatctgccgaagctggaaagccatctggaagcgcggctctggaacgag
gtgttcaattttgcgcaggattacctgggcatcccgcgcgggacaatccgggccaccgtg
ctgatcgagacgatcctggccgcgctggaaatggaggaaattctctacgagctgcgggat
catgccgccggactgaacgccgggcgctgggattacatcttcagttgtatcaaaaaattc
catgcgacggcgcccatctttccggaccgggcgcaggtgacgatgaccgtaccgttcatg
tatgcctacacggaactgctggtgaaaacctgccaccggcgcggcgcgcatgccatcggc
ggcatggccgccttcattccctcgcggcgcgatccggcggtcaacgaacgcgcgctggcc
gaagtgcgcaaagacaaggagcgggaggccggacagggcttcgacggcacctgggtggcc
catcccgatctggtaccggtggccgaggaggtgttcgatcgctatctgggcgatcggccg
caccagaaagaccggttgcgtgaggatgtgcaggtgacggccgacgatctgctggacttc
cgggtgccgggcgggcgcattaccgaaggcggcctgcgcaacaacgtaagcgtggcgttg
cagtatctgaaccagtggttctcgggcaacggggcggccgcgatcttcaatctgatggaa
gacgcggccacggccgagatcgcccgcgcgcagctctggcagtgggtccaccgcgaggcg
cgtctggacgacggccggcccatcacgccggagctgtacgcgcaggtgcgcgaagaagag
ctggcgaaactgggcgggcgcgacacggcccattaccgcgaggcggccgaggtgctcgac
tacctggtgctgtccgattccttcatcgaattcctgacgtttccggcctacgaacgtctg
ctgcagctggaaatggtgccgggctga

DBGET integrated database retrieval system