KEGG   Rhodothermus marinus DSM 4252: Rmar_2249Help
Entry
Rmar_2249         CDS       T01119                                 

Definition
(RefSeq) isocitrate lyase
  KO
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
rmr  Rhodothermus marinus DSM 4252
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:rmr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Rmar_2249
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Rmar_2249
Enzymes [BR:rmr01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     Rmar_2249
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2613092..2614378
Genome map
AA seq 428 aa AA seqDB search
MRQPIAAVKAARLEAEWRSNPRWAGIRRPYAAEDVLRLRGSVEIAYTLADRGARRLWELL
HTEPYVAALGALTGNQAMQQVKAGLKAIYVSGWQVAADANLAGQMYPDQSLYPSNSVPAL
VRRINNTLLRADQIHHAEGDDSIDWLVPIVADAEAGFGGPLHAFELTKALIEAGAAGVHF
EDQLASEKKCGHLGGKVLVPTGQFIQTLVAARLAADVMGVPTIIIARTDANAATLLTSDI
DERDRPFLTGERTPEGFFRVRAGLDQAIARALAYAPYADMIWCETSTPDLDEARRFAEAI
HREYPGKLLAYNCSPSFNWKKHLDEATIARFQRELAAMGYKFQFITLAGFHTLNYAMFEL
AYDYAREGMPAYVRLQQKEFAAMEKGFTAVRHQREVGTGYFDAVRTVITGEQASTVALAG
STEAQQFH
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atgcgtcaaccgattgccgctgtcaaagccgcccgtctcgaagccgaatggcgctccaat
ccccgatgggccgggatccgccgaccctacgccgccgaagatgtgctccgccttcgcggt
tcggtcgaaatcgcctatacgctggccgaccgcggcgcccggcgcctctgggaactgctc
cacaccgaaccctacgtggccgcgctcggcgccctgaccggcaaccaggccatgcaacag
gtcaaagccggactcaaggccatctacgtcagcggctggcaggtggccgccgacgccaac
ctggccggtcagatgtaccccgaccagagcctctacccctccaacagtgtcccggccctc
gtgcgccgcatcaacaacacgctgctgcgcgccgaccagattcaccatgccgaaggcgac
gactcgatcgactggctcgtgcccatcgtggccgacgccgaggccggcttcggcggcccg
ctccatgccttcgagctgaccaaggcgctcatcgaagccggtgccgccggggtccacttc
gaggaccagctcgcctccgaaaagaaatgcggccacctgggcggcaaggtgctcgtcccc
accggccagttcatccagacgctggtcgccgcccgcctggccgccgacgtcatgggcgtg
cccaccatcatcatcgcccgcaccgacgcgaacgccgccacgctgctcaccagcgacatc
gacgagcgggaccgtcccttcctcaccggcgaacgcacgcccgagggcttcttccgcgtc
cgggccgggctcgatcaggccatcgcccgcgccctggcctacgcgccctacgccgacatg
atctggtgcgagacgtccacgcccgacctggacgaggcccggcgcttcgccgaagccatc
caccgcgaataccccggcaaactgctggcctacaactgctcgccgtcgttcaactggaaa
aagcacctcgacgaggccaccattgcccgtttccagcgggagctggccgcgatgggctac
aagttccagttcatcacgctggccggcttccacacgctcaactacgccatgttcgaactg
gcctacgactatgcgcgcgaaggcatgccggcctacgtgcgcctgcagcagaaggagttt
gccgccatggagaagggctttacggccgtgcggcatcagcgcgaggtgggcaccggctac
ttcgacgccgtgcggacggtgatcaccggtgagcaggccagcacggtggccctggccggt
tccaccgaggcgcagcagttccactga

DBGET integrated database retrieval system