KEGG   Rhodothermus marinus DSM 4252: Rmar_2313Help
Entry
Rmar_2313         CDS       T01119                                 

Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
rmr  Rhodothermus marinus DSM 4252
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:rmr00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Rmar_2313
Enzymes [BR:rmr01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     Rmar_2313
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2681503..2682105
Genome map
AA seq 200 aa AA seqDB search
MIAYVSGKLAVKKLTEVVVDVHGLGYRLLIPTSTYEVLPEVGAPVHLLTHYYVREDAVLL
FGFATEAERALFEVLLGVSGVGPRLALAALSALSPAQIHEAVTTGDVQTLKRIPGVGQRL
AERLIVELRDRLALLDLAELTPAGVDDVRAQARVDALAALEALGLPRAAAERSLRKVLRE
HPGIQSAEELIRLALREHGG
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atgatcgcctacgtgtcgggcaagctggcggtcaaaaagctgaccgaggtggtggtggac
gtccacggcctgggctaccggcttctgattcccacgtccacctacgaagtgctgccggag
gtcggcgctccggtgcacctgctgacgcactactacgtgcgggaagatgccgtgctgttg
ttcgggtttgcgaccgaggccgagcgcgcgctgttcgaggtgctgctgggcgtgtcgggc
gtcggaccccggctggcgctggcggccctgtcggccctctctccggcacagattcacgaa
gcggtcaccacgggcgatgtgcagacgctgaagcgcatccccggcgtgggacagcggctg
gccgaacggctgatcgtggaactacgcgaccggctagcgctgctggatctggccgaactg
acaccggcgggcgtggacgatgtgcgcgcgcaggcccgtgtcgacgcactggcggcgctg
gaggcgctgggcctgccccgtgcggccgccgaacgcagcctgcgtaaggtgctccgggag
catccgggcattcagtcggccgaagaactcatccgcctggccctgcgcgagcacggcggc
taa

DBGET integrated database retrieval system