KEGG   Rhodothermus marinus DSM 4252: Rmar_2420Help
Entry
Rmar_2420         CDS       T01119                                 

Definition
3'(2'),5'-bisphosphate nucleotidase
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
rmr  Rhodothermus marinus DSM 4252
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:rmr00920]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2808431..2809420)
Genome map
AA seq 329 aa AA seqDB search
MDRMFTAEHEVALAAVREAAVLCRNIQAAIGPDVLEKKDRSPVTVADFGSQALICRRLAE
AFPDDPVMAEEDSAALREPAQAALLDRVVAEVRRLVPEATAEAVCAWIDRGNLTAYRPRF
WTLDPIDGTKGFLRGDQYAIALALVVEGQVQVAALACPNLPLTPGADAPRGVVFTAVRGE
GALAWPLEGEGEPVRVQVSATADPAQARFCESFESAHSAHDAAAEVARRLGITLPPRRLD
SQAKYAMVARGEADLYLRLPTRPGYVEKVWDHAAGVLIVTEAGGRVTDIHGRPLRFDLGP
TLAKNRGVVVSNGRLHAAVLEAIAAVGVA
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atggatcgcatgttcacggcagaacacgaggtggcgctggcggccgtacgcgaggcggcc
gtgctgtgccgcaacatccaggcggccatcgggcccgatgtgctggagaaaaaagaccgg
agtccggtcacggtggccgacttcggcagccaggcactcatctgcaggcggctggccgag
gcgtttccggacgatccggtcatggccgaagaggacagcgcggcgctgcgggagcccgcg
caggcggcgctgctggaccgcgtcgtggccgaggtacggcgcctggtgcccgaagccacg
gctgaagcggtatgcgcctggatcgaccgcggcaatctgacggcctaccgcccgcgcttc
tggacgctggatccgatcgacggcaccaaaggcttcctgcgcggcgaccagtacgccatt
gcgctggcgctcgtcgtggagggacaggtgcaggtggccgcgctggcctgtccaaacctg
ccgcttacgcccggcgcggacgcaccccggggcgtggtcttcacggccgtacggggcgaa
ggcgccctggcctggccgctggagggcgaaggagagcccgtgcgcgttcaggtgagcgcg
acggccgatcccgcgcaggcgcgcttctgcgagtcgttcgagtcggcccacagcgcgcac
gacgcggcggccgaggtggcccgacggctgggcatcacgttgccaccccggcggctcgac
agccaggccaagtacgccatggtggcacggggcgaggccgacctgtacctgcggctgccc
acgcggcccggttacgtcgaaaaggtgtgggaccacgcggccggcgtgctgatcgtaacc
gaggcgggcgggcgcgtgacagatattcatggccggccgctgcgcttcgacctggggccg
acgctggccaaaaaccggggcgtggtggtctccaacggccggctgcacgcggccgtgctg
gaagccatcgcggccgtcggcgtcgcgtag

DBGET integrated database retrieval system