KEGG   Rhodothermus marinus DSM 4252: Rmar_2469Help
Entry
Rmar_2469         CDS       T01119                                 

Definition
pectinesterase (EC:3.1.1.11)
Orthology
K01051  
pectinesterase [EC:3.1.1.11]
Organism
rmr  Rhodothermus marinus DSM 4252
Pathway
Pentose and glucuronate interconversions
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rmr00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Rmar_2469
   00500 Starch and sucrose metabolism
    Rmar_2469
Enzymes [BR:rmr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.11  pectinesterase
     Rmar_2469
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2875349..2877589)
Genome map
AA seq 746 aa AA seqDB search
MRWCRILLLGLLPLLGGAVETPEAVRVRVENPSDVARPDELVELAWAPLAERLPALTPEQ
VRVRDEASGRSVPHQVVDNDGDGRPDVLLFLVNLWPREARTYRVEAAAPETTFAARAFAY
HEPQRDDVAWESDRVAYRTYGQGLWQLESLVSSGIDVWLKRVRDLVITRWYAKGHDAYHI
DTGEGADFFSVGQSLGAGGTAIWHEGRLFPARNFKSYRILAAGPLRAIVELHYEPWEVGG
RQVSEVRRITIDAGQYLFREEVTFRAADSEPLTYAIGLVKREGVTGAWKQRDDWTWLGVW
GPVERKNGGHGELGTAVLMPGDRLEAVRETNDHYLLLGRMRPGEPVVHYAGAGWTAAGDF
RQVEDWWAYLDRFVQRFREPLRVAILTPSTGALRTAPDTYTYAAVVDPAYVGPEGARVDG
VRRYRTIGRALADVPADNDAPYVIFVRRGRYHEKLSIDRPFVYLIGEDRETTVLSYDDVA
GGPCADSPLRRALLARWQAENRSAQPRQPDRCGTRGSFTLRIAAPAVRVAHLTVENAFDY
PAYQDSLRDLQAVAVLIDREADRTVFYDCVIRGYQDTLFVEGNRSYFRNCTILGHVDFIF
GGGTAVFEACDLISRDRGRPNNGYVVAPSTPRSRPYGLIFHRCRLLKESPAMAPASVWLG
RPWHPSNQPGLVSSNAVFLHCYMDDHIRPEGWTEMHGVDPMGERLFEYGSSGPGAHPDRP
QLTAAEAALYAPAHVLAGWTPWRDLV
NT seq 2241 nt NT seq  +upstreamnt  +downstreamnt
atgcgctggtgcaggattctgctgctgggactgcttccgctgctgggcggagccgtcgaa
acgcccgaagcggtgcgcgttcgcgtggagaatccctcggatgtggcgcgtcccgacgag
ctggtcgagctggcctgggcgccgctggccgagcggcttccggccctgacgcccgagcag
gtgcgcgtgcgtgacgaggccagtggccgctcggtcccgcaccaggtggtggacaacgac
ggtgacgggcggccggacgtgctgctctttctggtgaacctctggccccgcgaggcgcgc
acctatcgcgtggaggccgcagccccggagacgacctttgccgcccgggctttcgcctat
cacgagccgcaacgcgacgatgtggcctgggaaagcgatcgggtggcgtatcgcacctac
ggccagggcctctggcagctggagtcgctcgtgtcgagcggcatcgacgtctggctcaag
cgcgtgcgcgatctggtgatcacccgctggtacgcgaaggggcacgacgcctatcatatc
gacacgggcgaaggcgccgactttttctccgtcggccagagtctgggcgccggcggcacg
gccatctggcacgagggacggctgtttccggcccgcaacttcaagtcgtaccgcatcctg
gccgccggtccgctccgggccatcgtggaactgcactacgaaccgtgggaggtgggcggc
cgccaggtgtcggaagtgcggcgcatcacgatcgacgccggacagtatctgtttcgggaa
gaagtgactttccgggcggccgatagcgagccgctgacctatgcgatcggactggtcaag
cgcgaaggggtaacgggcgcctggaagcagcgcgacgactggacctggctgggcgtctgg
ggaccggtcgagcgcaaaaatggcggacacggcgagctgggcacggccgtcctgatgccg
ggcgaccggctcgaagcggtgcgcgagaccaacgaccactacctgctgcttggccgcatg
cgtccgggcgaacccgtcgtgcactatgccggggcaggatggacggcggccggcgacttc
cgccaggtcgaagactggtgggcgtatctggatcgcttcgtgcagcgctttcgggagccg
cttcgggtggcgatcctcacgccatcgaccggcgccctgcgcaccgcgcccgacacgtac
acctacgccgccgtggtcgatccggcttacgtcggccccgaaggagcgcgcgtggacggg
gtgcggcgctaccggaccatcggccgggcgctggccgacgtgccggccgacaacgacgcc
ccctacgtgatcttcgtgcggcgtggccgctaccatgagaagctttccatcgaccggccc
ttcgtctatctgatcggcgaagatcgggagacgaccgtgctctcctacgacgacgtggcg
ggtggtccctgcgccgacagcccgctgcggcgggcgctgctggcacgctggcaggccgaa
aaccgctcggcacagccccgccaacccgaccgttgcggtacgcggggcagcttcacgctg
cgcattgccgcccctgcggtgcgcgtcgcccatctgaccgtggaaaacgccttcgactat
ccggcctatcaggacagcctgcgcgacctgcaggccgtagccgtgctcatcgatcgcgag
gccgaccgcaccgtcttctacgactgcgtgattcgcggctatcaggacacgctcttcgtc
gagggcaaccggagctattttcgcaactgtacgattctcggccatgtcgacttcattttc
ggcgggggcacggccgttttcgaagcctgcgatctgatttcgcgggatcgcggccggccc
aacaacggctacgtggtggcacccagcacgccccggagccgtccctacgggctgattttc
catcggtgtcgcctgctgaaggaatcgcctgcgatggctccggcctcggtgtggctggga
cgtccctggcatccctcgaaccagccggggctggtcagcagcaacgccgtttttctgcac
tgctacatggacgatcacattcggcccgagggctggacggagatgcacggcgtggatccg
atgggtgagcggcttttcgaatacggcagcagcgggccgggagcccatcccgaccggccg
cagctcacggcggcggaagcggcgctgtatgcgccggcccatgtgctggccggatggaca
ccctggcgagacctcgtctga

DBGET integrated database retrieval system