KEGG   Rhodothermus marinus DSM 4252: Rmar_2584Help
Entry
Rmar_2584         CDS       T01119                                 

Definition
(GenBank) pyruvate flavodoxin/ferredoxin oxidoreductase domain protein
  KO
K00169  
pyruvate ferredoxin oxidoreductase alpha subunit [EC:1.2.7.1]
Organism
rmr  Rhodothermus marinus DSM 4252
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:rmr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Rmar_2584
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Rmar_2584
   00020 Citrate cycle (TCA cycle)
    Rmar_2584
   00620 Pyruvate metabolism
    Rmar_2584
   00640 Propanoate metabolism
    Rmar_2584
   00650 Butanoate metabolism
    Rmar_2584
  Energy metabolism
   00680 Methane metabolism
    Rmar_2584
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Rmar_2584
Enzymes [BR:rmr01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Rmar_2584
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
3003479..3004678
Genome map
AA seq 399 aa AA seqDB search
MTLVVTPRLEAAQLLTGAQAVAHAMRQIEPDVVPVYPITPQTPIIEEFAQMVADGRCDTE
IVNVESEHSAMSAAVGASVAGARVMTATASQGLALMIEVLYIAASMRCPIVMPLGNRALS
GPINIHCDHSDAMLARDSGAVQIFTENGQEAYDYTLMAVRLAEDQRVLLPVIVNLDGFTL
THSAEAVELLPDEVARAFVGHYRPLYPLLDTVRPTTQGPFDMPDFYYEHKRQQDEAMRGV
LEVFPEVQRAYAEATGRNYRGYYEAYRLDDADFAVVVLGSTAGTAKVVVDTLRDEGQRVG
LLKLWLFRPFPHAAVAEALRGKQAVAVMDRALSFGSWGPLFTEIAAALYGLPEAERPRLH
NFTYGLGGRDVTPDQIAEALTRIQDPHTPAVMHYLGVRA
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atgacactcgtggtcactccccggctcgaagccgcccagttactgacgggcgcgcaggct
gtggcgcacgccatgcgccagatcgagcccgacgtcgtgccggtctatccgatcacgccg
cagacgccgatcatcgaagagtttgcgcagatggtggccgacggccgctgcgacaccgaa
atcgtcaacgtcgagtcggagcactcggccatgagcgcggccgtgggcgcttcggtggcc
ggcgcgcgcgtgatgacggccacggcctcgcagggcctggcgctgatgatcgaggtgctc
tacatcgcggcctccatgcgctgcccgatcgtgatgccgctgggcaaccgggcgctgagc
gggccgatcaacatccactgcgaccactccgacgccatgctggcccgcgattcaggcgcc
gtccagatcttcaccgaaaacggccaggaagcctacgactacacgctgatggccgtgcgc
ctggccgaagaccagcgggtgctgttgcccgtgatcgtcaatctggacggcttcacgctc
acgcattcggccgaggccgtcgagctgctgcccgacgaggtggcccgggcgttcgtgggc
cactatcggccgctctatccgctgctggacacggtgcgccccaccacgcagggcccgttc
gacatgcccgacttctactacgagcacaagcggcaacaggacgaggccatgcgaggcgtg
ctggaggtcttccccgaggtgcagcgcgcctacgccgaggccaccggccgcaactaccgg
ggttactacgaagcctaccggctcgacgatgcggactttgccgtggtcgtgctgggatcg
acggccggcacggccaaagtcgtcgtcgatacgcttcgggacgaagggcagcgggtgggt
ctgctcaagctgtggctcttccgacccttcccgcatgccgccgtggccgaagcgctgcgc
ggcaagcaggccgtggccgtgatggaccgggcgctgtcgttcggaagctgggggccgctc
ttcaccgaaattgccgcggccctgtacggcctgcccgaagccgagcgaccgcgcctgcac
aacttcacctatggtctgggagggcgcgacgttacgcccgaccagatcgccgaagcgctg
acccgcattcaggatccgcacacgcctgccgtcatgcactatctgggcgtgcgcgcctaa

DBGET integrated database retrieval system