KEGG   Rhodothermus marinus DSM 4252: Rmar_2585Help
Entry
Rmar_2585         CDS       T01119                                 

Definition
thiamine pyrophosphate TPP-binding domain-containing protein
Orthology
K00170  
pyruvate ferredoxin oxidoreductase, beta subunit [EC:1.2.7.1]
Organism
rmr  Rhodothermus marinus DSM 4252
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Class
Metabolism; Overview; Carbon metabolism [PATH:rmr01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:rmr00010]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:rmr00020]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:rmr00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:rmr00640]
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:rmr00650]
Metabolism; Energy metabolism; Methane metabolism [PATH:rmr00680]
Metabolism; Xenobiotics biodegradation and metabolism; Nitrotoluene degradation [PATH:rmr00633]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3004695..3005702
Genome map
AA seq 335 aa AA seqDB search
MMTGLSSNGETIRLKTLKELAEREQRALRFQGGHSLCAGCGVPLVVRTVLNAIDTPVVVV
NATGCLEVATTRYPSTAWNVPWLHVAFENAAAAASGVEAAFRVLNRKRKNGRPIPFDLPE
DVRIIAFGGDGGTYDIGLQALSGALERGHRFTYICYDNEAYMNTGNQRSGATPPLAHTTT
TPVGEQSLGKLQQRKDLTEIAVAHHVPYVAQASISNWQDLVRKIQMAVQVDGPSFLNVLA
PCQRGWGYDPSQTVEIARLAVETCFWPLYEVIDGEYRLNYRPRKPLPIAEWVKTQGRFRH
LLRPENRHLLDALQEQVNREWERLLRKCEGRLLEV
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
atgatgaccgggctttcctccaacggcgaaacgattcgcttgaagacgctcaaagaactg
gccgagcgtgaacagcgcgcgctgcgcttccagggcggccactcgctctgcgcgggttgc
ggcgtgccgctggtggtgcgcaccgtgctgaacgccatcgacacgcccgtggtcgtggtc
aacgcgacgggctgcctggaggtggccaccacgcgctatccttcgacggcctggaacgtg
ccctggctgcacgtggccttcgagaatgcggccgccgccgccagcggcgtggaggctgcc
ttccgggtgctcaaccgcaaacgcaaaaacggccggccgattcccttcgacctgcccgaa
gacgtgcgcatcatcgcctttggcggcgacggcggcacctacgacatcgggctgcaggcc
ctctcgggcgccctggagcgcgggcaccgcttcacgtacatctgctacgacaacgaagcc
tacatgaacacgggcaaccagcggagtggcgccacgcccccactggcccatacgaccacc
acgcccgtgggcgagcagagcctgggcaaactccagcagcgcaaggacctgacggagatc
gccgtcgcccaccacgtgccgtatgtggcccaggcgtcgatctcgaactggcaggatctg
gtgcgtaagatccagatggccgtgcaggtggacggaccgagctttctcaacgtactggcg
ccctgccagcgcggctggggctacgatccgtctcagaccgtcgagattgcccgcctggcc
gtcgaaacgtgcttctggccgctctacgaggtgatcgacggcgagtaccggctgaactac
cgaccgcgcaagccgctgcccatcgccgaatgggtcaaaacgcagggacgcttccgtcac
ctgctccgcccggagaaccgacacctgctcgacgcgctgcaggagcaggtcaaccgcgaa
tgggagcggctgctgcgcaaatgcgaaggacgcctgctggaagtgtag

DBGET integrated database retrieval system