KEGG   Rhodothermus marinus DSM 4252: Rmar_2585Help
Entry
Rmar_2585         CDS       T01119                                 

Definition
(GenBank) thiamine pyrophosphate protein domain protein TPP-binding protein
  KO
K00170  pyruvate ferredoxin oxidoreductase beta subunit [EC:1.2.7.1]
Organism
rmr  Rhodothermus marinus DSM 4252
Pathway
rmr00010  Glycolysis / Gluconeogenesis
rmr00020  Citrate cycle (TCA cycle)
rmr00620  Pyruvate metabolism
rmr00640  Propanoate metabolism
rmr00650  Butanoate metabolism
rmr00680  Methane metabolism
rmr01100  Metabolic pathways
rmr01120  Microbial metabolism in diverse environments
rmr01130  Biosynthesis of antibiotics
rmr01200  Carbon metabolism
Module
rmr_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:rmr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Rmar_2585
   00020 Citrate cycle (TCA cycle)
    Rmar_2585
   00620 Pyruvate metabolism
    Rmar_2585
   00640 Propanoate metabolism
    Rmar_2585
   00650 Butanoate metabolism
    Rmar_2585
  Energy metabolism
   00680 Methane metabolism
    Rmar_2585
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Rmar_2585
Enzymes [BR:rmr01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Rmar_2585
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TPP_enzyme_C DUF2065
Motif
Other DBs
NCBI-ProteinID: ACY49458
UniProt: D0MFW9
Position
3004695..3005702
Genome map
AA seq 335 aa AA seqDB search
MMTGLSSNGETIRLKTLKELAEREQRALRFQGGHSLCAGCGVPLVVRTVLNAIDTPVVVV
NATGCLEVATTRYPSTAWNVPWLHVAFENAAAAASGVEAAFRVLNRKRKNGRPIPFDLPE
DVRIIAFGGDGGTYDIGLQALSGALERGHRFTYICYDNEAYMNTGNQRSGATPPLAHTTT
TPVGEQSLGKLQQRKDLTEIAVAHHVPYVAQASISNWQDLVRKIQMAVQVDGPSFLNVLA
PCQRGWGYDPSQTVEIARLAVETCFWPLYEVIDGEYRLNYRPRKPLPIAEWVKTQGRFRH
LLRPENRHLLDALQEQVNREWERLLRKCEGRLLEV
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
atgatgaccgggctttcctccaacggcgaaacgattcgcttgaagacgctcaaagaactg
gccgagcgtgaacagcgcgcgctgcgcttccagggcggccactcgctctgcgcgggttgc
ggcgtgccgctggtggtgcgcaccgtgctgaacgccatcgacacgcccgtggtcgtggtc
aacgcgacgggctgcctggaggtggccaccacgcgctatccttcgacggcctggaacgtg
ccctggctgcacgtggccttcgagaatgcggccgccgccgccagcggcgtggaggctgcc
ttccgggtgctcaaccgcaaacgcaaaaacggccggccgattcccttcgacctgcccgaa
gacgtgcgcatcatcgcctttggcggcgacggcggcacctacgacatcgggctgcaggcc
ctctcgggcgccctggagcgcgggcaccgcttcacgtacatctgctacgacaacgaagcc
tacatgaacacgggcaaccagcggagtggcgccacgcccccactggcccatacgaccacc
acgcccgtgggcgagcagagcctgggcaaactccagcagcgcaaggacctgacggagatc
gccgtcgcccaccacgtgccgtatgtggcccaggcgtcgatctcgaactggcaggatctg
gtgcgtaagatccagatggccgtgcaggtggacggaccgagctttctcaacgtactggcg
ccctgccagcgcggctggggctacgatccgtctcagaccgtcgagattgcccgcctggcc
gtcgaaacgtgcttctggccgctctacgaggtgatcgacggcgagtaccggctgaactac
cgaccgcgcaagccgctgcccatcgccgaatgggtcaaaacgcagggacgcttccgtcac
ctgctccgcccggagaaccgacacctgctcgacgcgctgcaggagcaggtcaaccgcgaa
tgggagcggctgctgcgcaaatgcgaaggacgcctgctggaagtgtag

DBGET integrated database retrieval system