KEGG   Rhodothermus marinus DSM 4252: Rmar_2597Help
Entry
Rmar_2597         CDS       T01119                                 

Definition
alpha-galactosidase
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
rmr  Rhodothermus marinus DSM 4252
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:rmr00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Rmar_2597
  Lipid metabolism
   00561 Glycerolipid metabolism
    Rmar_2597
   00600 Sphingolipid metabolism
    Rmar_2597
Enzymes [BR:rmr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     Rmar_2597
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3016141..3017352
Genome map
AA seq 403 aa AA seqDB search
MRRLLLSLASLLVASVVFGQKFEQLARTPPMGWNSWNHFGCNINEQIVREVAQAMVRSGM
RDAGYEYVIIDDCWQGERDSLGFIQPDPERFPSGMKALADYIHSLGLKFGIYSDAGDRTC
AGRPGSRGHEYQDALTYARWGVDYLKYDWCHTENLNPIGAYTTMRDALYAAGRPVVFSIC
EWGTNEPWKWGRTIGHLWRTTGDITNCWDCIIDHGTWKSWGILQILDKQDGLRIYAGPGH
WNDPDMLEVGNGMRVSEDRAHFSMWAMLAAPLIAGNDIRHMSEATREILTNREVIAVDQD
TLGIQGFPYRREAGVEIWFRPLAGGDWAMAILNRTETPRTVTFNFREEYIFDDFSKRGTF
FDRITYRLRDLWAHRDIGTTETPLTVEVPGHDVVMLRLIAPKP
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atgcgacgactgctgttgagtctggcaagcctgctggtggccagcgtggtgttcggtcag
aaattcgagcaactggcccgaacgcccccgatgggctggaacagctggaatcacttcggc
tgcaacatcaacgagcagatcgtgcgcgaggtggcccaggccatggtacgctcgggcatg
cgcgatgccggctacgaatacgtgatcatcgacgactgctggcagggcgaacgcgacagc
ctgggcttcatccagcccgatcccgagcgtttcccgtcgggcatgaaggcgctggccgac
tacatccacagtctgggcctgaagttcggtatctattcggacgccggcgaccgcacctgt
gccggacggcccggcagccgcggccacgagtaccaggatgccctgacctacgcccgctgg
ggcgtcgattatctgaagtacgactggtgccatacggagaacctgaatcctattggcgcc
tacaccacgatgcgggatgcgctctatgcggccgggcgccccgtcgtcttcagcatctgt
gagtggggcacaaacgagccctggaagtggggccgcacgatcggccacctgtggcgcacc
accggcgacatcaccaactgctgggactgcatcatcgaccacggcacctggaagtcgtgg
ggcattctacagattctggacaagcaggacggcctgcgcatctatgccggtcccggccac
tggaacgaccccgacatgctggaggtgggcaacggcatgcgcgtcagcgaagaccgcgcc
cacttctcgatgtgggccatgctggccgctccgctcatcgccggcaacgacatccgccac
atgtcggaggccacccgcgaaatcctgaccaatcgggaggtgatcgccgtcgatcaggac
acgctgggcattcagggctttccctatcggcgagaggccggcgtggagatctggttccgg
ccgctggccggcggcgactgggcgatggccatcctgaaccgcaccgaaacgccccgcacc
gtgacgttcaacttccgggaagaatacatcttcgatgacttctcgaaacggggtaccttt
ttcgaccggatcacttaccgactgcgcgacctgtgggcgcaccgggacatcggcaccacc
gagacgccgcttaccgtcgaagtccccggccacgatgtggtcatgctccggttgatcgct
ccgaagccataa

DBGET integrated database retrieval system