KEGG   Rhodothermus marinus DSM 4252: Rmar_2610Help
Entry
Rmar_2610         CDS       T01119                                 

Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
rmr  Rhodothermus marinus DSM 4252
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:rmr00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Rmar_2610
DNA repair and recombination proteins [BR:rmr03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      Rmar_2610
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3032902..3033549
Genome map
AA seq 215 aa AA seqDB search
MSFTSPSVEALVEQLMRLPTVGRKTAQRLAAYILKMPREEVEALAQALLAVKERVRQCAI
CFNVTDEEVCAICRSPRRDHTTICVVEEPSDVLALERTGEYRGVYHVLGGVISPLDGIGP
DDLRIRELVARVAPANGDPERAALYPDGRIPRVQEVILALNPNVEGDTTAYYLAQLLKPL
GVRVTRIARGLPIGGDLEYADEATLSRALEGRLAL
NT seq 648 nt NT seq  +upstreamnt  +downstreamnt
atgagcttcacctcgccttcggtcgaagcccttgtcgagcagctcatgcggctgcccacc
gtcgggcgcaagacggcccagcggctggcggcctacattctgaagatgccccgcgaagag
gtcgaggcgctggcacaggccctgctggccgtcaaagagcgcgtgcgccagtgcgccatc
tgcttcaacgtgaccgacgaggaggtctgtgccatctgccgctcgccccgacgggaccac
accaccatctgcgtggtcgaagaacccagcgacgtgctggccctggagcgcaccggagag
taccggggcgtctaccacgtactgggcggcgtcatctcgccgctggacggtatcggcccg
gatgacctgcgcattcgcgaactcgtggcccgcgtggcgcccgccaacggcgaccccgag
cgggccgcgctctatccggacggtcgtattccgcgtgttcaggaagtcatcctggcgctg
aaccccaacgtcgagggcgacacaaccgcttactatctggcgcagctgctcaaaccgctg
ggcgtgcgcgtcacacgtattgcccgcggcctgcccatcggaggcgacctggagtatgcc
gacgaagctacgctctcccgtgcgctggagggacgcctggccctttaa

DBGET integrated database retrieval system