KEGG   Rhodothermus marinus DSM 4252: Rmar_2682Help
Entry
Rmar_2682         CDS       T01119                                 

Definition
magnesium protoporphyrin chelatase
Orthology
K03405  
magnesium chelatase subunit I [EC:6.6.1.1]
Organism
rmr  Rhodothermus marinus DSM 4252
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:rmr00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Rmar_2682
Enzymes [BR:rmr01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     Rmar_2682
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3106731..3108248)
Genome map
AA seq 505 aa AA seqDB search
MGQVLTELKTLGDLKEAGYRPLSVKDELRKNLIAKLRRGEEIFPGIIGYERTVIPQIQNA
ILGRHDMILLGLRGQAKTRIIRMLPELLDEYIPIIKGSEVNDNPFAPISKYGREMVADMG
DDTPIEWLHRSRRYAEKLATPDTTIADLIGDIDPIKAANRRLTYADEEVIHFGLIPRTNR
GIFAINELPDLQPRIQVGLLNILEEQDIQIRGFNIRFPLDILLVFTANPEDYTNRGNIIT
PLKDRIDSQIITHYPKTIEIGIAITQQEAWQERDGQVRVHVPYFFREIIEQIAFEARQSE
YVDQKSGVSVRMTRAALECLISAAERRALLNGEAETTVRLSDLLFVEPAITGKIELVYEG
EQEGVQNVARMLVGRAVKAIFPRYFPDPANRREGRAVYQPILDWFAKGGQVELTPELPFD
EYARRLDAVEGLCALVQRYTRPATPAETASMMEFVLEALHQHSLLGKDLLDQETRYSDIM
GSMLSSLGRDDDEEDEDDEFFRRYR
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
atgggacaggtgctgaccgaactgaagacgctgggggacctgaaggaggcaggctatcgg
ccgctgtcggtcaaggacgagctgcgcaagaacctgatcgccaagctgcggcgcggcgag
gaaatctttcccggcatcatcggctacgagcgaaccgtcattccccagatccagaacgcc
attctggggcggcacgacatgatcctgctcgggctgcgcggccaggccaaaacgcgcatc
atccgaatgctacccgagctgctcgacgaatacatcccgatcatcaagggcagcgaggtc
aacgacaatccgttcgctccgatctccaagtacggccgcgaaatggtggccgacatgggc
gacgatacgcccatcgaatggctccaccgaagccggcgctatgccgaaaagctcgccacc
cccgacacgaccatcgccgacctgatcggcgacatcgaccccatcaaggcggccaaccgc
cggctgacctacgccgacgaagaagtcatccactttggcctgattccccgcacgaaccgg
ggcatttttgccatcaacgaactgcccgacctgcaaccgcgcattcaggtgggcctgctc
aacatcctggaggagcaggacattcagattcgtggcttcaacattcgctttccgctcgac
attctgctcgtcttcacggccaacccggaggactacacgaaccgtggcaacatcatcacg
ccgttgaaggaccgcatcgacagccagatcatcacgcactacccgaagacgatcgagatc
ggcattgccatcacgcaacaggaggcctggcaggagcgcgacgggcaggtgcgcgtgcac
gtgccctacttcttccgggagatcatcgagcagatcgccttcgaggcgcgccagagcgag
tatgtagaccagaagtccggcgtgtcggtgcgcatgacgcgggcggcgctcgagtgcctg
atctcggcggccgagcggcgggccctgctgaacggcgaggcggaaaccaccgtgcgcctc
agcgacctgctcttcgtggagccggccatcaccggcaagatcgaactggtgtacgaaggc
gaacaggaaggcgtgcagaacgtggcccggatgctcgtcgggcgcgccgtcaaggccatc
ttcccgcgctacttcccggacccggccaaccgcagggaagggcgggccgtctaccagccc
attctggactggttcgcgaaaggcgggcaggtggagctgacgcccgagctccccttcgac
gagtacgcccgccggctggacgcggtggaggggctctgcgcccttgtgcagcgttacacg
cgtccggccaccccggccgagacggcgtcgatgatggaattcgtgctggaggcgctgcac
cagcactcgctgctcggcaaggatctgctcgaccaggagacccgctacagcgacatcatg
ggctcgatgctctcgtcgctgggccgggacgacgacgaagaggacgaagacgacgaattc
ttccgccgctaccgatga

DBGET integrated database retrieval system