KEGG   Rhodothermus marinus DSM 4252: Rmar_2797Help
Entry
Rmar_2797         CDS       T01119                                 

Definition
beta-N-acetylhexosaminidase
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
rmr  Rhodothermus marinus DSM 4252
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:rmr00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Rmar_2797
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    Rmar_2797
Enzymes [BR:rmr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     Rmar_2797
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3250543..3253119
Genome map
AA seq 858 aa AA seqDB search
MQSFCYLLLTGLLPALALARHPERLTVYWGVLANQDNGRARWELTLVNQDTVALPASGWT
LYFNFMRPILSESTPPSVRLTHVNGDFYRLEPTEAFAPLPPGGRRTLSFESPGPLIKAID
APSGLYFVFRDAPDRPIPVRDVRVLPFASEFQTRRHPADRLPVPTPALRYYRNASLRLLP
ADSLTPVVPTPRQLTRREGHWTLDRTAAIAYDPALAREAAFLADALAPLLGTRLRLLEGA
ERPASIRLRLGAVYLPDGPAGPEAYHLIVDPEAGITLTGTDAAGAFYGIQTLQQLIDPSF
YRQTSETIPIPALEVRDAPRFGYRGLHLDVARNFQPKEVVLRLLDLMARYKLNRFHFHLT
DDEGWRLEIEDLPELTEVGGCRGHTETEATCLVPSHGSGPIPGRPPGSGYYTREDFIEIL
RYATARHIEVIPEIDVPGHARAAIKAMEARYARLKAAGRPEAEAAAYRLVDPADTSVYRS
VQGWNDNVINVCLPSTYRFLEKVVDELRRLYDEAGAPLHVVHTGGDEVPHGAWAGSPACR
AVMQAEGIDDPAALQQYFLDRFDQILRRRGLRTAGWEEIGLIATEENGRRVHRPNPRFRD
RGFLVYAWNNIWGSGAEDHAYRLANAGYDVILSLASNLYFDLAYTKHPDEAGLYWAGFVD
NDAPYRLEPFDLFLGPIQHWLGHTLPPEAFAHHERLTTEGRRHIVGLQGQLWGETLRTPD
RVFYMAVPRMLALAERAWAERPAWSQIVDPEARQQALQAAWNAFANRLGQRELPRLDALY
GETAPYRLPPPGAVVEDGLLKANVALPGLTIRYTLDGSEPTAASPRYTGPVRLEGHGEVR
LRTFDTNGRGSRTVRVVY
NT seq 2577 nt NT seq  +upstreamnt  +downstreamnt
atgcagagcttctgttatctgctgctgaccggcctgctgcccgccctggcgctggcccgg
caccccgaacgcctgaccgtttactggggcgtgctggccaaccaggacaacggccgggcc
cgctgggaactgacgctggtcaatcaggacaccgtggcgctgcccgcttcgggctggacg
ctctacttcaacttcatgcgtccgatcctgtccgaaagcaccccgccttcggtccgcctc
acgcacgtcaacggcgacttctaccgcctggagcccaccgaggcgttcgcgccgctgcca
ccggggggacgccgcacgctttcgttcgaatccccgggaccgctcatcaaggctatcgac
gcgccctcgggcctctattttgtctttcgcgacgcgccggaccgtccgattccggtgcgg
gacgtgcgcgtgctgcccttcgcctcggagtttcagacgcggcggcatccggccgatcgg
ctgcccgtgcccaccccggccctgcgctactaccggaacgcatcgcttcggctgctaccg
gccgatagcctgacgccggtcgttcccactccgcgccagctcacgcgccgagaaggacac
tggacgctcgaccgcacggccgccatcgcctacgatcccgccctggcccgtgaggcggcc
tttctggccgacgccctggcgccgctactgggcacgcggcttcgcctgctggaaggtgcc
gaacggcccgcttcgatccgcctgcgcctcggcgcggtttacctgcccgacggcccggcc
ggccccgaggcctaccacctgatcgtggacccggaagcgggcattacgctcaccggcacc
gacgcggccggggccttctacggcatccagacgctgcaacagctcatcgatccgtccttc
tatcgacagacgtccgagaccatcccgatcccggcgctcgaagtgcgcgatgcgccgcgc
ttcggctaccggggactgcacctcgacgtggcccgcaacttccagccgaaagaagtggtg
ctccggctgctcgacctgatggcgcgctacaagctcaaccggttccactttcacctgacc
gacgacgagggctggcgcctggagatcgaggacctgcccgaactgaccgaggtgggcggc
tgtcgcggccacaccgaaacggaagcaacctgtctggtaccctcgcacggctccggaccg
atccccggccggccgcccggaagcggctattacacacgcgaagactttatcgaaatcctg
cgctacgccacggcccgacacatcgaggtgatccccgagatcgacgtgcccggccacgcc
cgcgcggccatcaaagccatggaagcccgctatgcccgtctgaaggcggcaggccgcccc
gaagccgaagcggccgcctaccggctggtcgacccggccgacacgtccgtctaccgctct
gtgcagggctggaacgacaatgtgatcaacgtctgcctgccctcgacctaccgctttctg
gaaaaggtggtggacgaactccggcggctctacgacgaagccggtgcgccactccacgtg
gtgcatacgggcggcgacgaagtgccgcacggggcctgggccggctcgcccgcctgccgg
gccgtcatgcaggctgaaggcatcgacgatccggccgcgctgcagcagtacttcctggac
cggttcgatcagatcctgcgacggcgcgggctgcgcacggcgggctgggaagagatcggg
ctgatcgccaccgaggaaaacggacggcgcgtgcatcgtcccaatccacgcttccgcgat
cggggcttcctggtctacgcctggaacaacatctggggcagcggggccgaggatcacgcc
taccggctcgccaatgcgggctacgacgtgatactctcgctggcctcgaacctgtacttc
gacctggcctacacgaagcatcccgacgaggccggcctctactgggcgggcttcgtggac
aacgacgcgccgtaccgcctggagccgttcgatctgtttctggggccgatccagcactgg
ctgggccacacgctcccgcccgaagcgttcgcccaccacgagcgcctgacgaccgaggga
cggcgtcacatcgtgggcctgcagggacagctctggggcgagacgctccgcacaccggac
cgcgtcttctacatggccgtaccccgaatgctggcgctggccgaacgcgcctgggccgag
cggccggcctggagccagatcgtcgatccggaagcccgccagcaggccctgcaggcggcc
tggaacgcgtttgctaaccgactgggtcagcgcgaactgccccggctcgacgcgctctac
ggcgagacggcgccctatcgcctgccgccgcccggtgccgtcgtcgaggacggccttctg
aaggccaacgtggcgctcccgggtctgacgatccgctacacgctggacggcagcgagccc
acggccgcctcgccccggtacacggggccggtccggctcgaagggcacggcgaggtgcgc
ctgcgcacattcgacacgaacggacgcggcagccgcaccgtacgcgtggtctactga

DBGET integrated database retrieval system