KEGG   Rickettsia massiliae MTU5: RMA_0066Help
Entry
RMA_0066          CDS       T00605                                 

Gene name
aco1
Definition
(GenBank) Acyl-CoA desaturase 1
  KO
K00507  stearoyl-CoA desaturase (Delta-9 desaturase) [EC:1.14.19.1]
Organism
rms  Rickettsia massiliae MTU5
Pathway
rms01040  Biosynthesis of unsaturated fatty acids
rms01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:rms00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    RMA_0066 (aco1)
Enzymes [BR:rms01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     RMA_0066 (aco1)
Lipid biosynthesis proteins [BR:rms01004]
 Desaturase
  First
   RMA_0066 (aco1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FA_desaturase PRESAN DUF3177 Dna2
Motif
Other DBs
NCBI-ProteinID: ABV84380
UniProt: A8F0E4
Position
complement(57665..58858)
Genome map
AA seq 397 aa AA seqDB search
MLSKLNKPALFALIFYPIFIISLIVKYSFDYGIGLTEVIFIIASYYINNITVGIGLHRLW
SHNAYKINKYAEFVLIMLSAGTLQGPALSWASNHYKHHRYTDQDQDPHTPLKFDNKFLGF
MWSHIGWMLVGSGSYKSIDRITWAKHGKNNLLKWQLKYYWQIAAFMNIVVPLFIGYLVGG
TIQSAYAGFLFMGLGRFLQQQATFCVNSLCHFAGSKKYYKGTAGDIWWMALFLLGENWHN
YHHAFPSDYRNGAKWYHFDVHKWIIFLMSKIGLASELERTAKVRIQAKMQETLSYLSEKQ
KQKLTLMQTKIDHLLENLCLKIKELEESSITIKEQFKKSFVEIQESLKNLAEQVSSTTQI
TEKPSEKLLKIVNNKIIDAEQSIYKLYNQLNTLKVSN
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgttaagtaaactaaataagcccgctttatttgctttaatattttatcctatttttatt
atatctcttatagttaaatattcgtttgattatggaatagggctaactgaagttattttt
ataattgctagttattatattaataatattaccgttgggatcggtttgcataggttatgg
tctcataatgcttataaaataaataaatatgccgagtttgtcttaattatgctgtctgca
gggacattacaaggaccagctttatcttgggcatcgaatcattataaacatcatagatat
acggatcaagaccaagatccgcatactcctttaaaatttgataataaatttttaggcttt
atgtggtctcatataggatggatgctagtcggaagcggtagctataagtctattgatcgc
attacttgggctaagcacgggaaaaacaatttattaaaatggcagctaaaatattattgg
caaatagcagcttttatgaatattgtcgtgcctttatttatcggttacttagtcggcggt
actatacaatcggcatatgcaggatttttatttatggggctcggtagattcctacagcaa
caagcaaccttctgcgttaattctttatgccactttgccggtagtaaaaaatattacaaa
ggcactgccggagatatttggtggatggcattattcttactcggtgaaaattggcataat
taccatcatgcttttccttcagattatcgtaacggtgcaaaatggtatcattttgacgtt
cacaaatggataatatttttaatgagtaaaatcggtttagcttcagaacttgaacgtact
gcaaaagtacgtatacaggcaaaaatgcaagaaactttaagctatcttagtgaaaaacaa
aagcaaaaattgactttaatgcaaactaaaatagatcatttattagaaaatctatgctta
aaaattaaagagcttgaagaatcatctattactattaaagaacaatttaaaaaatctttt
gtagaaatacaagaatcacttaaaaatttagcggagcaagtaagttctacaacgcaaata
acagaaaaaccttcggaaaaactattaaaaatagttaataacaaaattattgatgccgaa
caatctatttataagctgtataatcaattaaataccttaaaggtatctaattag

DBGET integrated database retrieval system