KEGG   Rickettsia massiliae MTU5: RMA_0177Help
Entry
RMA_0177          CDS       T00605                                 

Gene name
sdhD
Definition
(GenBank) Succinate dehydrogenase hydrophobic membrane anchor protein
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
rms  Rickettsia massiliae MTU5
Pathway
rms00020  Citrate cycle (TCA cycle)
rms00190  Oxidative phosphorylation
rms00650  Butanoate metabolism
rms01100  Metabolic pathways
rms01110  Biosynthesis of secondary metabolites
rms01120  Microbial metabolism in diverse environments
rms01130  Biosynthesis of antibiotics
rms01200  Carbon metabolism
Module
rms_M00009  Citrate cycle (TCA cycle, Krebs cycle)
rms_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
rms_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:rms00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    RMA_0177 (sdhD)
   00650 Butanoate metabolism
    RMA_0177 (sdhD)
  Energy metabolism
   00190 Oxidative phosphorylation
    RMA_0177 (sdhD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt tRNA_anti_2 CybS PAP2
Motif
Other DBs
NCBI-ProteinID: ABV84471
UniProt: A8F0N5
Position
172806..173183
Genome map
AA seq 125 aa AA seqDB search
MVYDFKAAIVKAKNSGSAKSGSHHWLLQRVTGIILALCSVWLIYFTLTNKNNDINIIMWE
LKKPFNVVALLITVVISLYHAMLGMRVVIEDYISCYKLRNTLIIIVQLFCIVTIVAFVVA
IFYKG
NT seq 378 nt NT seq  +upstreamnt  +downstreamnt
atggtatatgattttaaagcagcaattgtaaaagcaaaaaatagcggttctgctaaaagc
ggttctcatcattggttattgcaaagagtaacggggattatattagctttatgttctgtg
tggctaatatattttacgttaaccaacaaaaataatgatataaatattattatgtgggag
cttaaaaagccttttaatgtagtagctttgttaattacggtggttatttcgttgtatcat
gcgatgcttggtatgcgtgtagtaattgaggattatataagttgttacaaattacgtaat
acattgattataatagtgcaattattttgcattgtgactattgtagcttttgtagtagcg
atattttataaaggataa

DBGET integrated database retrieval system