KEGG   Rickettsia massiliae MTU5: RMA_0177Help
Entry
RMA_0177          CDS       T00605                                 

Gene name
sdhD
Definition
succinate dehydrogenase hydrophobic membrane anchor protein
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
rms  Rickettsia massiliae MTU5
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:rms00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    RMA_0177 (sdhD)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    RMA_0177 (sdhD)
   00650 Butanoate metabolism
    RMA_0177 (sdhD)
  Energy metabolism
   00190 Oxidative phosphorylation
    RMA_0177 (sdhD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
172806..173183
Genome map
AA seq 125 aa AA seqDB search
MVYDFKAAIVKAKNSGSAKSGSHHWLLQRVTGIILALCSVWLIYFTLTNKNNDINIIMWE
LKKPFNVVALLITVVISLYHAMLGMRVVIEDYISCYKLRNTLIIIVQLFCIVTIVAFVVA
IFYKG
NT seq 378 nt NT seq  +upstreamnt  +downstreamnt
atggtatatgattttaaagcagcaattgtaaaagcaaaaaatagcggttctgctaaaagc
ggttctcatcattggttattgcaaagagtaacggggattatattagctttatgttctgtg
tggctaatatattttacgttaaccaacaaaaataatgatataaatattattatgtgggag
cttaaaaagccttttaatgtagtagctttgttaattacggtggttatttcgttgtatcat
gcgatgcttggtatgcgtgtagtaattgaggattatataagttgttacaaattacgtaat
acattgattataatagtgcaattattttgcattgtgactattgtagcttttgtagtagcg
atattttataaaggataa

DBGET integrated database retrieval system