KEGG   Rickettsia massiliae MTU5: RMA_0238Help
Entry
RMA_0238          CDS       T00605                                 

Gene name
sucB
Definition
dihydrolipoamide succinyltransferase
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
rms  Rickettsia massiliae MTU5
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:rms00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    RMA_0238 (sucB)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    RMA_0238 (sucB)
  Amino acid metabolism
   00310 Lysine degradation
    RMA_0238 (sucB)
Enzymes [BR:rms01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     RMA_0238 (sucB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(239328..240533)
Genome map
AA seq 401 aa AA seqDB search
MMSVKIIVPSLGESVTEATIAKWYKQEGDSVKTDELLLEIETEKVTLEVNAPCNGTIGKI
SKTDSANVAVGEEIGEINEGAAANTAGTHHNESAKAQAATQPTSEKPVEKPAVANNTLAP
SVQKLVTENKLDPNNIKGTGRDGRITKGDVLETINTTATSAPAISKSNEERVQRVRMSRL
RKTIAQRLKDSQNTAAILTTFNEIDMSKVIALRNQYKEEFEKKHAVKLGFMSFFVKATIE
ALKLIPSVNAEIDGDDLVYKNYYDIGVAVGTEQGLVVPIVRDADKMGFAEVEKAIGILAK
KAREGKLSMADLSGGTFSISNGGVYGSLLSTPIINPPQSGILGLHKTEERAVVIDGKIEI
RPMMYIALSYDHRIIDGKEGVSFLVKIKQLIENPEKLLLDL
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
attatgagcgttaaaattatagtaccgtcacttggggagtccgtaacggaagcaactatt
gccaaatggtataagcaagaaggcgattcggttaaaaccgatgaattactgttagaaatc
gaaaccgaaaaagtgactttagaagtgaatgctccttgcaacggtactataggtaaaata
tcgaaaactgacagtgcaaatgtagcagttggcgaagaaataggcgaaataaatgaaggg
gcagctgcaaatactgccggtactcatcataatgaatctgctaaagctcaagcagcgacg
caacctacttcagaaaagcctgtagaaaaacctgccgtggctaataatactcttgctcct
tctgtacaaaaattagttaccgaaaataagcttgaccccaataatatcaaaggaacaggt
agagacggtagaattaccaaaggtgacgtgcttgaaacaataaacactacggctacttct
gctcctgcaataagtaaatctaatgaagaaagagtgcagcgtgttcgtatgtcacgcttg
cgtaaaactattgcacagcgtttaaaagattcacaaaatacagcagctattttgactact
tttaatgaaatcgatatgtcaaaagtaattgctttgcgtaatcaatataaagaagagttt
gagaaaaagcacgctgtgaaacttgggtttatgtctttctttgttaaagcaacaattgaa
gctttaaagcttattccgtcggtaaatgctgaaatagacggcgatgatttagtatataaa
aattactatgatataggtgtagctgtcggaacagagcaagggcttgttgtaccgattgtt
agggatgccgataaaatgggatttgccgaagtggagaaagctataggaattttggctaaa
aaagctcgtgagggtaagctttctatggctgatttgtcaggtgggacattctcgatttct
aacggaggcgtatatggctcattattatctacaccgattattaatcctcctcaatcaggt
attctaggcttacataaaaccgaggaaagagctgtagttatagacggtaaaattgaaata
cgtccgatgatgtatatagctttatcttacgatcatcgtataattgacgggaaagaagga
gtatcgttcttagtaaaaattaagcagcttattgagaatcctgaaaagttattgttagat
ttgtaa

DBGET integrated database retrieval system