KEGG   Rickettsia massiliae MTU5: RMA_0238Help
Entry
RMA_0238          CDS       T00605                                 

Gene name
sucB
Definition
(GenBank) Dihydrolipoamide acetyltransferase component
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
rms  Rickettsia massiliae MTU5
Pathway
rms00020  Citrate cycle (TCA cycle)
rms00310  Lysine degradation
rms01100  Metabolic pathways
rms01110  Biosynthesis of secondary metabolites
rms01120  Microbial metabolism in diverse environments
rms01130  Biosynthesis of antibiotics
rms01200  Carbon metabolism
Module
rms_M00009  Citrate cycle (TCA cycle, Krebs cycle)
rms_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:rms00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    RMA_0238 (sucB)
  Amino acid metabolism
   00310 Lysine degradation
    RMA_0238 (sucB)
Enzymes [BR:rms01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     RMA_0238 (sucB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H RnfC_N
Motif
Other DBs
NCBI-ProteinID: ABV84522
UniProt: A8F0T6
Position
complement(239328..240533)
Genome map
AA seq 401 aa AA seqDB search
MMSVKIIVPSLGESVTEATIAKWYKQEGDSVKTDELLLEIETEKVTLEVNAPCNGTIGKI
SKTDSANVAVGEEIGEINEGAAANTAGTHHNESAKAQAATQPTSEKPVEKPAVANNTLAP
SVQKLVTENKLDPNNIKGTGRDGRITKGDVLETINTTATSAPAISKSNEERVQRVRMSRL
RKTIAQRLKDSQNTAAILTTFNEIDMSKVIALRNQYKEEFEKKHAVKLGFMSFFVKATIE
ALKLIPSVNAEIDGDDLVYKNYYDIGVAVGTEQGLVVPIVRDADKMGFAEVEKAIGILAK
KAREGKLSMADLSGGTFSISNGGVYGSLLSTPIINPPQSGILGLHKTEERAVVIDGKIEI
RPMMYIALSYDHRIIDGKEGVSFLVKIKQLIENPEKLLLDL
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
attatgagcgttaaaattatagtaccgtcacttggggagtccgtaacggaagcaactatt
gccaaatggtataagcaagaaggcgattcggttaaaaccgatgaattactgttagaaatc
gaaaccgaaaaagtgactttagaagtgaatgctccttgcaacggtactataggtaaaata
tcgaaaactgacagtgcaaatgtagcagttggcgaagaaataggcgaaataaatgaaggg
gcagctgcaaatactgccggtactcatcataatgaatctgctaaagctcaagcagcgacg
caacctacttcagaaaagcctgtagaaaaacctgccgtggctaataatactcttgctcct
tctgtacaaaaattagttaccgaaaataagcttgaccccaataatatcaaaggaacaggt
agagacggtagaattaccaaaggtgacgtgcttgaaacaataaacactacggctacttct
gctcctgcaataagtaaatctaatgaagaaagagtgcagcgtgttcgtatgtcacgcttg
cgtaaaactattgcacagcgtttaaaagattcacaaaatacagcagctattttgactact
tttaatgaaatcgatatgtcaaaagtaattgctttgcgtaatcaatataaagaagagttt
gagaaaaagcacgctgtgaaacttgggtttatgtctttctttgttaaagcaacaattgaa
gctttaaagcttattccgtcggtaaatgctgaaatagacggcgatgatttagtatataaa
aattactatgatataggtgtagctgtcggaacagagcaagggcttgttgtaccgattgtt
agggatgccgataaaatgggatttgccgaagtggagaaagctataggaattttggctaaa
aaagctcgtgagggtaagctttctatggctgatttgtcaggtgggacattctcgatttct
aacggaggcgtatatggctcattattatctacaccgattattaatcctcctcaatcaggt
attctaggcttacataaaaccgaggaaagagctgtagttatagacggtaaaattgaaata
cgtccgatgatgtatatagctttatcttacgatcatcgtataattgacgggaaagaagga
gtatcgttcttagtaaaaattaagcagcttattgagaatcctgaaaagttattgttagat
ttgtaa

DBGET integrated database retrieval system