KEGG   Rickettsia massiliae MTU5: RMA_0409Help
Entry
RMA_0409          CDS       T00605                                 

Gene name
cysQ
Definition
3'(2'),5'-bisphosphate nucleotidase
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
rms  Rickettsia massiliae MTU5
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:rms00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    RMA_0409 (cysQ)
Enzymes [BR:rms01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     RMA_0409 (cysQ)
Transfer RNA biogenesis [BR:rms03016]
 Eukaryotic Type
  tRNA degradation factors
   Rapid tRNA decay (RTD) pathway factors
    RMA_0409 (cysQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
412476..413258
Genome map
AA seq 260 aa AA seqDB search
MIMNNNLINALKDLIINTGKIALDIKKAGILTDIKSDGSVVTNADKEISKIIYQTLQTLT
SQIAIVCEEQPLPIFSSDTFWLIDPIDGTWSYVNGKSTYTVNIGLIENGFPTIGLIYHPE
TAKLYYTDVNGRLKIEQNSKEIFVNHEPKHEEFNAVIGFYNSNKATKEFLSKYSFGQINA
IGSSIKLCLIAEGAADIYPKFGQTMEWDIAAGHALIKAGGGNILDTHGQEITYGKESFAN
PNFFACSKYWLEREARLHRY
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
ataattatgaataacaatttaattaatgctttaaaagatttaattattaataccggcaag
attgcactagatataaaaaaggcaggaatattgactgatattaaatcagatgggtcagta
gtcactaatgctgataaggaaattagtaaaataatttatcaaactctacaaaccttaacc
tctcaaatagctatagtatgtgaagagcagccgctacctatattcagcagtgatactttt
tggttaatcgatcctattgatgggacatggagctatgtaaacggtaaaagtacatatacg
gtcaatatagggcttattgaaaacggttttccaaccatcggcttgatatatcaccctgaa
acagcaaagctatattataccgatgtaaacggtcggttaaaaatcgaacagaattctaaa
gaaatatttgttaatcatgaacctaaacatgaagagtttaatgcggtaataggtttttat
aattcaaataaagctactaaagaatttttaagtaagtattcattcggtcaaataaatgca
ataggcagttcaattaaactatgcttaattgctgaaggagcagctgatatatatccaaaa
ttcggtcaaactatggaatgggacatagcggcaggtcatgctttaattaaagccggtggt
ggtaatattttagatacgcatggacaagaaattacttacggtaaagaaagtttcgctaat
cctaattttttcgcctgtagtaaatattggttggaaagggaggcaaggttgcatagatac
tag

DBGET integrated database retrieval system