KEGG   Rickettsia massiliae MTU5: RMA_0545Help
Entry
RMA_0545          CDS       T00605                                 

Gene name
folE
Definition
(GenBank) GTP cyclohydrolase I
  KO
K01495  GTP cyclohydrolase IA [EC:3.5.4.16]
Organism
rms  Rickettsia massiliae MTU5
Pathway
rms00790  Folate biosynthesis
rms01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rms00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    RMA_0545 (folE)
Enzymes [BR:rms01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     RMA_0545 (folE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_cyclohydroI QueF
Motif
Other DBs
NCBI-ProteinID: ABV84738
UniProt: A8F1F2
Position
535396..535965
Genome map
AA seq 189 aa AA seqDB search
MSKPTREEAKEAVRTLLKFIGEDPSREGLLKTPDRVINSYAEIFSGYGKDVAKILNTKFY
ETCNFQDFILLNIKFTSFCEHHILPFNGTVDIAYVPDNCIVGISKLARIVNIFARRLQIQ
EKMTVQIAESVQENLKPLGVAVKISAVHSCMSMRGVMQDNSVMNTMHYTGIFAEQQKYRH
EFLNLTAKR
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaaccaactagagaagaagctaaagaggcagtaagaacgttactaaaattcatt
ggtgaagatccaagcagagaagggctgcttaaaacgcctgatagagtaattaatagctac
gcagaaatattttccggttatggaaaggatgtagcaaaaatattaaataccaagttttat
gaaacttgtaattttcaagattttatcttactgaatataaaatttacctctttctgtgaa
catcatatattaccttttaacggtacagtagatatagcttatgttcctgataattgtatt
gtcggcatcagtaagctagcacgaatagtaaatatttttgctagaagactacaaatccaa
gaaaaaatgacggtacagatagcagaaagcgtgcaggagaatttaaagccgcttggcgtt
gccgttaagatttctgccgtacatagctgtatgtcaatgcgtggcgtaatgcaagataat
agcgttatgaataccatgcattatacgggtatatttgccgaacagcagaaatatcgtcat
gagtttttaaaccttactgctaaaaggtga

DBGET integrated database retrieval system