KEGG   Rickettsia massiliae MTU5: RMA_0549Help
Entry
RMA_0549          CDS       T00605                                 

Gene name
ruvA
Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
rms  Rickettsia massiliae MTU5
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:rms03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
538965..539603
Genome map
AA seq 212 aa AA seqDB search
MVKRKSKYMIGKLSGKVDSQGDDYVIIDVNGVGYLVYASGKTLGKLAEGEFYKLFIETHV
REEHIHLYGFLTLEEKNFFNLLQSVNGIGTRMALSILSSLTPSDIQIAVNNEDKNIFKAI
SGVGAKLAERVVLELKGKVAKISSGSAIIKDSLNIKNITPVASNEVIKALVNLGFSRFEA
QNAVQGIITQNPEISIDELIKTALKNRNSIFS
NT seq 639 nt NT seq  +upstreamnt  +downstreamnt
atagtaaaaagaaaaagtaaatatatgatcggtaaattaagcggtaaagttgattcccaa
ggcgatgattacgttataattgacgtaaacggggtagggtacttagtctatgcttcaggt
aaaactttaggtaaacttgctgaaggggagttttataaactatttatcgaaacccatgtt
agagaggaacatattcatctttacggttttttgactctagaagagaagaatttttttaat
ttgctacaatcagtaaacggtataggtacaagaatggctttatctatcttatcaagcctt
acgccttcggacattcaaattgctgtaaataatgaagataaaaatatatttaaagcaata
tccggagtaggggctaaacttgctgaacgtgtagtgctagagctgaaaggtaaagtagcg
aaaatatcaagcggttcagctattattaaagatagcttaaatattaagaatatcacaccc
gttgcaagtaatgaagtaataaaagctctagtaaatctaggattttctagatttgaagct
caaaacgccgttcaaggcatcattacccaaaatcccgaaatctctattgatgaattaatc
aaaacagccctgaaaaatcgaaattcaatttttagttga

DBGET integrated database retrieval system