KEGG   Rickettsia massiliae MTU5: RMA_0623Help
Entry
RMA_0623          CDS       T00605                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
rms  Rickettsia massiliae MTU5
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:rms00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    RMA_0623 (recR)
DNA repair and recombination proteins [BR:rms03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      RMA_0623 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
612161..612772
Genome map
AA seq 203 aa AA seqDB search
MFMNETNDNDIDQLIYLFSKLPGLGSRSARRIALYLLQDKDVRLKSLINNLVEIDKKIVK
CKICGNIDTENICRICSSEYRDKSIIAIVETVAELWAMERSGNFKGLYHVLGHNLSAASR
QNPSILRLPELLKRCFAENIKEVIIATNSTLEGQTTAYFITEYLKEHPAKISRLASGIPI
GGELDYLDEGTVSAAINLRQPFE
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
atatttatgaatgaaacaaatgataatgatatagatcagctaatttatcttttttcaaaa
ttacccggtcttggtagtagatcggcaagacgtatagcgctttacctattgcaagataaa
gacgtaaggttaaaaagcctgattaataatcttgtagagatagataagaaaatagtaaaa
tgcaagatttgcggtaatatagatacggaaaatatttgccgtatttgttcttctgaatat
agagataaatcaattattgctattgttgaaacagtggctgaattatgggcaatggagcgt
agcggtaattttaaaggtttatatcatgtactcggtcataatttatcggcagctagtaga
caaaaccctagcatacttcggttacctgaactacttaaaagatgttttgcagaaaatatt
aaagaagttattattgctactaattctactttagaaggtcagactactgcttattttatt
acagaatatttaaaagagcatcctgctaaaatttctcgccttgctagcggtatacctatc
ggaggtgaacttgattatttagacgagggtaccgtatctgccgctattaacctacgccaa
ccttttgagtaa

DBGET integrated database retrieval system