KEGG   Rickettsia massiliae MTU5: RMA_0623Help
Entry
RMA_0623          CDS       T00605                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
rms  Rickettsia massiliae MTU5
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:rms03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
612161..612772
Genome map
AA seq 203 aa AA seqDB search
MFMNETNDNDIDQLIYLFSKLPGLGSRSARRIALYLLQDKDVRLKSLINNLVEIDKKIVK
CKICGNIDTENICRICSSEYRDKSIIAIVETVAELWAMERSGNFKGLYHVLGHNLSAASR
QNPSILRLPELLKRCFAENIKEVIIATNSTLEGQTTAYFITEYLKEHPAKISRLASGIPI
GGELDYLDEGTVSAAINLRQPFE
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
atatttatgaatgaaacaaatgataatgatatagatcagctaatttatcttttttcaaaa
ttacccggtcttggtagtagatcggcaagacgtatagcgctttacctattgcaagataaa
gacgtaaggttaaaaagcctgattaataatcttgtagagatagataagaaaatagtaaaa
tgcaagatttgcggtaatatagatacggaaaatatttgccgtatttgttcttctgaatat
agagataaatcaattattgctattgttgaaacagtggctgaattatgggcaatggagcgt
agcggtaattttaaaggtttatatcatgtactcggtcataatttatcggcagctagtaga
caaaaccctagcatacttcggttacctgaactacttaaaagatgttttgcagaaaatatt
aaagaagttattattgctactaattctactttagaaggtcagactactgcttattttatt
acagaatatttaaaagagcatcctgctaaaatttctcgccttgctagcggtatacctatc
ggaggtgaacttgattatttagacgagggtaccgtatctgccgctattaacctacgccaa
ccttttgagtaa

DBGET integrated database retrieval system