KEGG   Rickettsia massiliae MTU5: RMA_0702Help
Entry
RMA_0702          CDS       T00605                                 

Gene name
pdhC
Definition
(GenBank) Pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
rms  Rickettsia massiliae MTU5
Pathway
rms00010  Glycolysis / Gluconeogenesis
rms00020  Citrate cycle (TCA cycle)
rms00620  Pyruvate metabolism
rms01100  Metabolic pathways
rms01110  Biosynthesis of secondary metabolites
rms01120  Microbial metabolism in diverse environments
rms01130  Biosynthesis of antibiotics
rms01200  Carbon metabolism
Module
rms_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:rms00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RMA_0702 (pdhC)
   00020 Citrate cycle (TCA cycle)
    RMA_0702 (pdhC)
   00620 Pyruvate metabolism
    RMA_0702 (pdhC)
Enzymes [BR:rms01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     RMA_0702 (pdhC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 CAT QRPTase_N
Motif
Other DBs
NCBI-ProteinID: ABV84856
UniProt: A8F1S0
Position
695171..696409
Genome map
AA seq 412 aa AA seqDB search
MPIKILMPALSPTMTEGNLARWLKKEGDKVNPGEVIAEIETDKATMEVEAVDEGILAKIV
IPQNSQNVPVNSLIAVLSEEGEEKTDIDAFIAKNNSVSPSPKTDANLLKPHENIANVEEQ
VTVIKHDASKIFASPLAKRLAKMGNIRFESVKGSGPHGRIVKQDILSYTPSTAHNKIVSR
NPEEYRLVPNNNIRKIIAKRLFESKQTVPHFYLSIECNVDKLLDIREDINKSFSEDKSTR
ISVNDFIILAVAKALQEVPNANASWGEDAIRYYNNVDISVAVAIENGLVTPIVKNANQKN
ILELSREMKELIKKAKDNKLTPEEFQGGGFTISNLGMYGIKNFNAIINPPQGCIMGVGAS
AKRAIVKNDQITIATIMDVTLSADHRVVDGAVGAEFLAAFKKFIESPALMLI
NT seq 1239 nt NT seq  +upstreamnt  +downstreamnt
atgccgattaaaattttaatgcctgctttatctccaactatgacggaaggaaatctagct
aggtggttaaaaaaagaaggggacaaagttaatcctggagaagtaattgctgaaattgaa
accgataaagcaacgatggaagtagaagcagtagacgaaggtatacttgccaaaatagtt
atcccacaaaatagtcaaaatgtacctgttaactctttaattgccgtgttaagtgaagag
ggagaagaaaaaacggacattgatgcgtttattgcaaaaaataatagtgtatcaccgtca
ccgaaaacagatgctaatcttctgaaaccccacgagaacatagctaatgtagaagaacag
gtaacagttataaaacatgatgctagtaaaatattcgcctcaccgcttgcaaaaagactt
gcaaaaatgggaaatattagatttgagagcgtgaaaggtagcggtccgcacggtagaata
gtcaaacaggatatcttatcatatactcctagcactgctcataataaaatagttagcaga
aatcctgaagaatatcgtttagtaccaaataataatatccgcaagattatagccaagcgt
ctgtttgaatctaaacaaacagttccacatttttatttatctatagaatgtaatgtcgat
aaattgttagatatacgagaagacattaataaatctttttctgaagataaatcaacaagg
atatcggttaatgattttattattttagcagtagccaaagctttacaagaagtgccaaat
gccaatgctagctggggagaagatgcaattagatattataataatgtcgatatttcagta
gcggtagcgattgagaacgggcttgttacgccgatagttaaaaatgccaatcaaaaaaac
attctagaactatctcgtgaaatgaaagaattaataaagaaagcaaaagataataaatta
acccctgaagaatttcagggcggagggtttaccatttctaacctcggtatgtacggtatt
aagaatttcaatgctataattaacccaccgcaaggttgtataatgggcgtcggagctagt
gcaaaacgtgctatagtcaagaatgatcaaatcactatagcaacaattatggacgtaact
ctttctgccgatcaccgagtagtagacggagcagtcggtgctgagttcttggcagcattt
aaaaagtttatagagagtcccgctttgatgttgatataa

DBGET integrated database retrieval system