KEGG   Rickettsia massiliae MTU5: RMA_0944Help
Entry
RMA_0944          CDS       T00605                                 

Gene name
murE
Definition
UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-diaminopimelate ligase
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
rms  Rickettsia massiliae MTU5
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Class
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:rms00300]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:rms00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(939839..941293)
Genome map
AA seq 484 aa AA seqDB search
MNIINMSHNLKQLFQQHNVKGLSINSKTVKDKDVFFTIKGRNTDGNDFIKDALSKGAVLV
ITDNKKNIVIDKVIYVKDVQAALYEAIEIFYPKTPKNLIAVTGTNGKSSVVSYIAQTYSL
LGKKAASIGTIGVEIFGCDNLINDVPELTTLDYLSFRKIAHNLAENGIEYLVFEASSHGL
DQARLREIKVNIACFTSFSQDHLDYHHTKENYLLAKLKLFINHLLPNGIAILNSDIEEIE
FVKDYLHNHNIKFITVGKKGDLEITRINGSLKGQNINFTFNNREYNFNTPIIGSFQASNL
LIAVLSIHYTGFAFDDVIDSLVEVKAVKGRMERIDNTHIFVDYAHTPDALAKALTELKNI
KLRGSKLSVVFGCGGNRDKAKRSLMGQIAAKHADTIIITDDNPRNEDPKLIRAEIISGIE
KADYTEIANREEAIKYGINNLKQDDTLLVAGKGHENYQIIGDKKLPFDDAEVVRKCVKVC
HPVA
NT seq 1455 nt NT seq  +upstreamnt  +downstreamnt
ttgaacataataaatatgtcccataacctaaagcaattatttcaacaacataacgtaaaa
ggtttgtcgattaattctaaaaccgttaaggataaagacgtcttttttacgattaaagga
cggaatactgatggaaatgattttattaaggatgctttaagcaaaggtgcagtattagta
attacggacaataaaaaaaatattgttatagataaagtaatttacgtaaaagatgtgcag
gcagctttatatgaagccatagaaatattctatcctaaaacaccaaagaatctaatagcc
gtaaccggtactaacggtaaaagctcggtagtatcctatatagctcaaacatattcatta
cttgggaaaaaagcagcatctataggtacgataggggtagaaatatttggctgcgataat
cttataaatgatgtaccggaattaacaactttagactatttaagctttagaaaaattgct
cataatttagctgaaaatggtatagaatatttagtttttgaagcttctagtcatggtctt
gatcaagcaagacttagggaaataaaagtaaatattgcatgttttactagctttagtcag
gatcatctagattaccaccatacaaaagaaaattatttattagccaaactgaaattattt
ataaatcatttattaccgaacggcatcgcaatattaaattctgatatagaagaaatagag
tttgttaaagattatctacataatcataatattaaatttataaccgttgggaaaaaaggt
gatttagaaatcactagaattaacggttctttaaaaggacaaaatattaattttacattt
aataatagagaatataattttaataccccgataattggtagctttcaggctagtaattta
ttaattgctgttcttagcattcattatactggttttgcttttgatgatgttatagattct
ttagtagaagttaaagcagtaaaaggcagaatggagagaatagataacactcatatcttc
gttgattatgcccacactccggacgctcttgcaaaagctttaacggaactgaaaaatatt
aaattacgtggtagtaaactaagcgtagtttttggctgcggcggtaatcgtgataaggca
aagagaagtcttatggggcaaatagccgcaaaacatgccgataccatcataattacagat
gataatccacgcaatgaagacccaaagcttattagagctgaaatcataagcggtatagag
aaagcagattatacagaaatagcaaatagagaagaggctattaaatacggtataaataat
ttaaaacaagatgataccttgttagttgccggcaaaggtcatgaaaattaccaaattata
ggcgataagaaattaccttttgatgatgctgaggttgtgaggaagtgtgtaaaagtttgt
catcccgtggcttga

DBGET integrated database retrieval system