KEGG   Rickettsia massiliae MTU5: RMA_1070Help
Entry
RMA_1070          CDS       T00605                                 

Gene name
mutM
Definition
(GenBank) Formamidopyrimidine-DNA glycosidase
  KO
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
rms  Rickettsia massiliae MTU5
Pathway
Base excision repair
Brite
KEGG Orthology (KO) [BR:rms00001]
 Genetic Information Processing
  Replication and repair
   03410 Base excision repair
    RMA_1070 (mutM)
Enzymes [BR:rms01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.23  DNA-formamidopyrimidine glycosylase
     RMA_1070 (mutM)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.99  Other carbon-oxygen lyases
    4.2.99.18  DNA-(apurinic or apyrimidinic site) lyase
     RMA_1070 (mutM)
DNA repair and recombination proteins [BR:rms03400]
 Prokaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     RMA_1070 (mutM)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1055012..1055851
Genome map
AA seq 279 aa AA seqDB search
MPELPEVETLKNSLKDKLIGLIVENVELKRDNLRYKLSPLLATEILNTNILDVRRRAKYL
IIDFNNDYSLIVHLGMSGRFTLQSANYKTQKHDHVIFDLSNGEKLIFNDTRRFGMIYSFK
TDLLEQEFFNDLGIEPFSDLLTLEYLKDKLQTRKRPIKNLIMDNRVIVGVGNIYASESLH
LARIHPDKSGSDLRDDEIENLIKSIRDVLTKAITAGGTTLKDFVNGDNKPGYFTQQLTVY
GKEGQSCLSCSSTIIKTKHSGRSTFYCKTCQYRLASFTI
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
atgccggaacttcctgaagtagaaactcttaaaaactctctaaaagataagctaatcggg
cttattgtagaaaatgtagagttaaaaagagataatttacgttataagctatccccgctt
ttagctacagaaatcttaaatactaatatactggatgttaggcgtcgtgcaaaatattta
attatagattttaataatgattattctttaatagttcatctaggcatgagcggtagattt
actctgcaatctgctaattataaaactcaaaaacacgatcatgtgatttttgatttaagt
aacggcgaaaagttaattttcaacgatactagacgcttcggtatgatttatagttttaag
actgatctcttagaacaagaattttttaatgatttaggcatagagcctttttctgattta
ttgacgttagaatatctaaaagataagctacaaactagaaaaagaccgataaaaaacttg
attatggataatagagttatagtcggagtcggtaatatctatgcttccgaaagtcttcat
ttagctagaattcatccggataaatcaggtagcgatttaagggatgatgaaatagaaaat
ttaattaaatcaattagagatgtgttaactaaagctataactgccggcggtactactctt
aaagattttgtaaacggcgataacaaacctggttattttactcagcaacttacggtttac
ggtaaagagggacaaagttgtttaagctgctctagcactattatcaagacaaaacattca
ggcagaagtactttttattgtaaaacttgccaatatagattggcaagttttacaatttaa

DBGET integrated database retrieval system