KEGG   Rickettsia massiliae MTU5: RMA_1210Help
Entry
RMA_1210          CDS       T00605                                 

Gene name
gmk
Definition
guanylate kinase
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
rms  Rickettsia massiliae MTU5
Pathway
Purine metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:rms00230]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1177818..1178537)
Genome map
AA seq 239 aa AA seqDB search
MLYLRNKTENMTIKNKRVLQKFAYREEFKGDMERSTAAMSKLPLEVELSRNSKGLIIILS
SPSGTGKSSLAKALLKIDNNLRLSISATTRKPRSGEVEGIHYYFKTGLEFEKLVKQNKFL
EYAKIYDNYYGTPKEYVEMLLNQGLDVLFDIDWQGARSIKKNATNVVAIFVLPPNIEVLE
QRLRNRATDNEEAIKLRMQSAQNEISHANEYDYVVTNDDFDRTLKKIHAIIVAEREKAF
NT seq 720 nt NT seq  +upstreamnt  +downstreamnt
atgctgtacctacgcaataaaacagaaaatatgacaataaaaaataaaagagttcttcag
aaattcgcttatagagaggaatttaaaggagacatggaacgtagcaccgcagcgatgtct
aaattacctctagaagtagaactttcgaggaactctaaaggactgattataattttatct
tccccttcaggtacaggtaagtcgagtttagctaaagcattattgaaaatagataataat
ttgcgtttatctatttcggcaactacaagaaaaccacgttcaggagaagtagagggtata
cactattactttaagaccggtctagagtttgaaaaattagttaagcagaataaattcctt
gaatatgctaaaatatacgataattattacggtacgcctaaagaatatgtcgaaatgtta
ttaaatcaaggcttggatgttttgtttgatattgattggcaaggagcaaggagtattaag
aaaaatgctactaatgttgttgctatatttgtattgcctcctaatattgaagtattggaa
caacgcttaagaaatagagcgaccgataatgaagaagcaataaaattacgtatgcagtcg
gcacaaaacgaaatatcacatgctaatgagtatgattatgtagttactaacgatgacttt
gaccggacgcttaaaaaaatacatgcgattatagttgcagaacgagaaaaagcgttttga

DBGET integrated database retrieval system