KEGG   Rickettsia massiliae MTU5: RMA_1358Help
Entry
RMA_1358          CDS       T00605                                 

Gene name
dapE
Definition
succinyl-diaminopimelate desuccinylase
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
rms  Rickettsia massiliae MTU5
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:rms00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    RMA_1358 (dapE)
  Amino acid metabolism
   00300 Lysine biosynthesis
    RMA_1358 (dapE)
Enzymes [BR:rms01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     RMA_1358 (dapE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1328223..1329371
Genome map
AA seq 382 aa AA seqDB search
MMYINYLKDLIGFKSVTPKSDGAIEYIDDLLKQHGFKTEIKIFGDSKSEQVTNLYAVFGS
NEPNICFVGHVDVVLAGNHELWHNASPFKASQQDDKIYGRGAVDMKGAIACFLAASLDFI
KNNTDFKGSISFLLTSDEEGKAKHGTKEMLQYIYDQGYKINFAIVGEPTCEKEIGDAIKI
GRRGSVNFKLNIEGLSGHVAYPHKANNPLPCLIIILNELTNIKLDEGIEFFQRSNLEVTN
IEVSNNTSNVIPASTEASFNIRFNNLHSAETLAKQVEEIIKQHCKEYKVDYKLEYSSSAE
SFIQNPSDKIKEFAKVVEHTLKIKPEFSTSGGTSDARFVKNYCPLVEFGLLSETAHKINE
YTKISDLQKLYDVYYNFLMEIL
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
ttgatgtacattaactacttaaaagatttgattggttttaagtctgtaactcctaagagc
gatggggctattgagtatattgatgatttgcttaaacagcacggctttaagaccgaaata
aaaatattcggtgattctaaaagcgagcaagtcactaatctttatgctgttttcggtagc
aatgagcctaatatttgctttgttggtcatgtagatgtagtgctggcaggcaatcatgag
ctttggcataatgcgagtccatttaaagctagccagcaagacgataagatatatggcaga
ggtgcggtggatatgaaaggggctatagcgtgctttctagctgccagtttagattttata
aaaaataataccgattttaaaggttccattagtttcttacttactagtgatgaagaggga
aaagcaaagcatggtactaaagaaatgctgcaatatatttatgatcaaggatataagata
aattttgctattgtcggtgaacctacttgtgaaaaagaaataggcgatgcaattaagatt
ggcagaagaggaagtgttaactttaaattaaatatagaaggcttaagcgggcatgtagct
tatcctcataaagcaaataacccattgccttgcttaataataatattgaatgagttaaca
aatataaaacttgatgaaggtattgaattttttcaacgttcaaatcttgaagtaacgaat
atcgaggtcagtaataatacttcaaacgtaattccggcaagtacggaagcatctttcaat
atacgttttaataatttacatagtgcagaaactttagcaaaacaggtagaagaaattatt
aaacagcattgtaaagaatataaagtagattataagttagaatatagtagttctgctgaa
agttttattcagaaccctagcgataaaataaaagaatttgctaaagtagtagagcatacg
cttaaaataaagcctgaattctctacaagcggcggtacgtcggatgcaagattcgtcaaa
aattattgtccgttagtagagtttggtttattatccgaaacggcacataaaataaacgaa
tacacaaaaattagcgatttacaaaaattatatgatgtgtattataactttttgatggaa
atactttaa

DBGET integrated database retrieval system