KEGG   Rickettsia massiliae MTU5: RMA_1359Help
Entry
RMA_1359          CDS       T00605                                 

Gene name
holC
Definition
(GenBank) DNA polymerase III chi subunit HolC
  KO
K02339  DNA polymerase III subunit chi [EC:2.7.7.7]
Organism
rms  Rickettsia massiliae MTU5
Pathway
rms00230  Purine metabolism
rms00240  Pyrimidine metabolism
rms01100  Metabolic pathways
rms03030  DNA replication
rms03430  Mismatch repair
rms03440  Homologous recombination
Module
rms_M00260  DNA polymerase III complex, bacteria
Brite
KEGG Orthology (KO) [BR:rms00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    RMA_1359 (holC)
   00240 Pyrimidine metabolism
    RMA_1359 (holC)
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    RMA_1359 (holC)
   03430 Mismatch repair
    RMA_1359 (holC)
   03440 Homologous recombination
    RMA_1359 (holC)
Enzymes [BR:rms01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     RMA_1359 (holC)
DNA replication proteins [BR:rms03032]
 Prokaryotic Type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     RMA_1359 (holC)
DNA repair and recombination proteins [BR:rms03400]
 Prokaryotic Type
  SSBR (single strand breaks repair)
   MMR (mismatch exicision repair)
    DNA polymerase III holoenzyme
     RMA_1359 (holC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_pol3_chi
Motif
Other DBs
NCBI-ProteinID: ABV85290
UniProt: A8F304
Position
1329524..1329994
Genome map
AA seq 156 aa AA seqDB search
MFMQQFSIYQTSDELLLKSILLLIEKCYYSDLKSVILTADADQQEMLNKNLWTYSRKQFI
PHGSKLDPQPEKQPIYITDELQNPNNASVLVIISPTDIGKILQAKEYIRVFKRIIIITDL
PEDLKELTVKINKFTGQENKIDCFTQNPRGAWSKVV
NT seq 471 nt NT seq  +upstreamnt  +downstreamnt
atttttatgcagcaatttagtatttatcaaacaagcgatgaattgcttctaaagtcgata
ttgcttctgatagaaaaatgctattactctgatcttaaaagcgtgatattaactgcagat
gcagatcaacaagaaatgctcaataaaaatctttggacttattcacgtaagcaatttata
cctcacggtagtaaacttgatccgcagcctgaaaaacagccgatttatattaccgatgag
ttacaaaatcctaataatgctagtgtgcttgttattatttcgcctacagatataggaaaa
attttacaagcaaaagaatatataagagttttcaaaaggataattataataaccgattta
ccggaagatttaaaagaattaacagttaaaataaataaatttaccggacaggaaaacaaa
atagattgttttactcaaaatcctcgtggagcttggagtaaagtagtctaa

DBGET integrated database retrieval system