KEGG   Rothia mucilaginosa: RMDY18_01520Help
Entry
RMDY18_01520      CDS       T01144                                 

Definition
GTP cyclohydrolase I
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
rmu  Rothia mucilaginosa
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:rmu00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
161437..162033
Genome map
AA seq 198 aa AA seqDB search
MEQRMSEAKNAVDQPRIEAAVREILLAIGEDPDRDGLQQTPARVARAYAEFFSGLHQDAG
EILGTTFDIAHSEMVLVKDIPFYSTCEHHLVPFHGVAHVGYIPGPDGKVTGLSKLARVVD
LYARRPQVQERLTTQVVEALEEHLNPRGAIVVIEAEHMCMSMRGVRKPGAKTVTSAVRGA
LMNGATRAEAMSLIFSQR
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atggagcagagaatgagcgaggctaagaacgctgtcgaccagccgcgtattgaggctgcc
gtccgtgagattctgctcgcgatcggtgaggacccggaccgtgacggcttgcaacagacc
cctgcacgtgtggcgcgtgcctacgccgagttcttctcgggcctgcaccaggacgccggc
gagattctgggtacgaccttcgacatcgcccactctgagatggtgctggtgaaggacatt
ccgttctactcgacctgtgagcaccacctggtgccgttccacggcgtggcgcatgtgggt
tacattccgggcccggacggtaaggttaccggcctgagcaagctcgcccgcgtggtggat
ttgtacgctcgccgcccgcaggtgcaggagcgtctgaccacgcaggtggtggaggctctg
gaggagcacctgaacccgcgcggcgcgattgtggtgattgaggctgagcacatgtgcatg
tcgatgcgcggtgtgcgtaagccgggcgcgaagaccgtgactagcgcggtgcgcggtgcg
ctgatgaacggcgcaacccgtgcggaggcgatgagcctgatcttctcgcagcgctaa

DBGET integrated database retrieval system