KEGG   Rothia mucilaginosa: RMDY18_01550Help
Entry
RMDY18_01550      CDS       T01144                                 

Definition
dihydropteroate synthase
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
rmu  Rothia mucilaginosa
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:rmu00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
163925..164995
Genome map
AA seq 356 aa AA seqDB search
MQVLNAVSPESPPQLPQPPPQVTAANMGAPQIRYDKPMTESTHTTRVAPLPCDALAAERT
LVMGILNVTPDSFSDGGQHYAAADAIARAARMIAEGASIIDIGGESTRPGAVRISVEEEQ
RRILPVIEAVAQMGTTISVDTMNPQTARAAIAAGAHIINDVSGLNVSNEMIETAAELQVP
YILMHARGTSQTMDSLAEYPRGVVTEVVEELTDLRERFLAAGVLPQNLILDLGLGFAKGG
MQDWELLAALDELQGLGHRLLIAGSRKRFIANALTAADMALAERLNASGFTATDAGEAER
ELWQSLSEPRPAEHRAAASAAVTALVAARGVWAVRVHDVPASVDAVTVASALRSVS
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atgcaagtattgaatgccgtgtcaccagaatcgcccccacagctgccccaacccccgccc
caagtcactgcggcaaacatgggagcaccgcagattcggtacgataaacccatgactgaa
tccacacacaccacccgtgtagcccccttgccctgcgacgcgctcgccgccgaacgcacc
ctcgtgatgggcatcctcaacgtcacccccgactccttcagcgacggcggccagcactac
gccgccgccgacgccatcgcccgcgccgcccgcatgattgccgagggcgcctccattatc
gacattggcggcgagtccacccgccccggtgccgtgcgcatcagcgtggaggaggagcag
cgccgcatcctgcccgtcatcgaggcagtcgcgcagatgggcaccaccatcagcgttgac
accatgaacccgcagaccgctcgcgccgccattgccgccggtgcgcacatcatcaacgat
gtgtccggtctgaacgtgagcaatgaaatgattgaaaccgccgctgaactgcaggtgccg
tacatcctcatgcacgcccgcggcacctcccagaccatggacagcctggcggagtacccg
cgcggcgtggtcaccgaggttgtggaggagctgaccgatctgcgtgagcgtttccttgcc
gccggtgtgctgccgcagaacctgattcttgacctgggtctgggctttgcgaagggcggc
atgcaggactgggagctgctcgccgcccttgacgagctacagggcttgggccaccgcctg
ctcattgctggttcccgcaagcgttttatcgcgaacgccctcacggcggcggatatggcg
ctggctgagcgcctgaacgcgagcggcttcaccgcaaccgatgcgggcgaggcggaacgc
gaactgtggcagtcgctgtcggagccgcgcccggctgagcaccgtgcggcagcctccgcg
gcggtgaccgccctggtggcggcgcgcggcgtgtgggcggtgcgcgtgcacgacgtgccc
gccagcgtggatgcggtgacggtcgcctccgcgctgcgctccgtaagctaa

DBGET integrated database retrieval system