KEGG   Rothia mucilaginosa: RMDY18_01590Help
Entry
RMDY18_01590      CDS       T01144                                 

Definition
7,8-dihydro-6-hydroxymethylpterin-pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
rmu  Rothia mucilaginosa
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rmu00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    RMDY18_01590
Enzymes [BR:rmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     RMDY18_01590
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
165477..166097
Genome map
AA seq 206 aa AA seqDB search
MAGTQTTDTQKPNTLKHRAVLALGSNLGESEDTLERAVADLVAGGVQLVRASGLYRTAPV
GGPAGQPDFVNAVIEVTTDLGAYELLRLCNAVEAAHHRERLVRWGPRTLDIDVIDYDGVI
SEDPVLTLPHPRAQERAFVLVPWAQMDPQARLTVTHRAKPSGERPDEVPEPLSREVVNVA
ELSRTLLGADEDAISYMREMQVPDQP
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
gtggctggcacccagacaaccgatacgcagaagcccaacaccctgaaacaccgcgcggtg
ctggcgttgggctcgaatctgggcgaaagcgaagacaccctggagcgtgccgtcgccgac
ctggtggcgggcggcgtgcagctggtgcgcgcctccgggttgtaccgtaccgccccggtg
ggtggcccggcgggtcagccggatttcgtgaacgcggtcattgaggtgaccactgacctg
ggcgcctacgagctgctgaggctgtgtaatgcggtggaggcggcgcatcaccgtgagcgc
ctggtgcgttggggcccgcgcaccctcgatattgacgtgattgactatgacggcgtgatc
tctgaggatccggtgctgactttgccgcatccgcgggcgcaggagcgtgcttttgtgctg
gtgccgtgggcgcagatggacccgcaggcgcgcctgacggtgacgcatcgtgcgaagcct
tcgggggaacggccggatgaggtccctgagccgctgagccgcgaggtcgtgaatgttgcg
gagctgtcccgcacgctgcttggtgcggatgaagacgctattagctatatgcgtgagatg
caggtacctgatcagccttaa

DBGET integrated database retrieval system