KEGG   Rothia mucilaginosa: RMDY18_04110Help
Entry
RMDY18_04110      CDS       T01144                                 

Definition
dihydrofolate reductase
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
rmu  Rothia mucilaginosa
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:rmu00790]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:rmu00670]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(433270..433938)
Genome map
AA seq 222 aa AA seqDB search
MMYRLGAIWAQTDAGIIGRAGDMPWYAPEDLAHFKKVTLGAPVIMGRRTWESFPPRFRPL
PGRTNIVISRSVTEAEERDGALWVPSLDAALYAARDAVGAPVEATPADTATDAPAVDAWI
IGGGSVYAEALSRNDLPAFGRVKTVERTLFYCQEGNEITGDTRAPELQLADSHGNCATGS
PNGCWHVVSETAWEKSEKGYLLDESGTKNPMYFSFQRLERLP
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atgatgtatcgtctgggcgctatttgggctcaaactgatgctggcatcattggtcgagcc
ggggatatgccctggtacgctccggaggatttggcgcacttcaagaaggtgacgctgggc
gctccggtgattatgggtcgccgcacctgggagtcgttcccgccgcgttttcgtcccctg
ccgggtcgcaccaatattgtgattagccgttcggttaccgaggcggaagaacgcgatggt
gccctgtgggttccctcgctggatgcggccctgtacgcggctcgcgacgccgtgggcgca
ccggttgaagctaccccggcagataccgctacagatgcccccgcggttgatgcctggatt
attggtggcggctccgtctacgcggaggcgctctcccgcaacgacctgcccgccttcggt
cgggtgaagacggtggagcggaccctcttctactgccaggaaggcaacgagattaccggc
gatacgcgagcgcccgaactgcagctcgcggactctcacggaaactgcgcgacaggctcc
ccaaacggatgctggcacgtggtctccgagacggcctgggagaagagcgagaaggggtat
ctgctcgatgagtcgggcacgaagaaccccatgtacttctccttccagaggctcgaacgt
ctcccctaa

DBGET integrated database retrieval system