KEGG   Rothia mucilaginosa: RMDY18_04230Help
Entry
RMDY18_04230      CDS       T01144                                 

Definition
6-phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
rmu  Rothia mucilaginosa
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:rmu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    RMDY18_04230
   01230 Biosynthesis of amino acids
    RMDY18_04230
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RMDY18_04230
   00030 Pentose phosphate pathway
    RMDY18_04230
   00051 Fructose and mannose metabolism
    RMDY18_04230
   00052 Galactose metabolism
    RMDY18_04230
  Energy metabolism
   00680 Methane metabolism
    RMDY18_04230
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    RMDY18_04230
Enzymes [BR:rmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     RMDY18_04230
Protein phosphatases and associated proteins [BR:rmu01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     RMDY18_04230
Messenger RNA biogenesis [BR:rmu03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     RMDY18_04230
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(443174..444232)
Genome map
AA seq 352 aa AA seqDB search
MRRHQQGANMKIGLLTSGGDCPGLNAVIRGAVLNGVKKYGYEFVGFRDGWRGVVEGDYMD
LPRQKVRGLASQGGTIIGTSRTNPFDGPNGGPENIEIMMERHGIDAIVAIGGEGTLAGAK
RLADAGLPVIGVPKTIDNDLRATDYTFGFDTAVSIATEAMDRIRTTGESHHRCMVAEVMG
RHVGWIALHSGMAAGAHAILIPEVKVSMEQVAEWVKEVHDRGRSPLVVVAEGFIPEGFDD
VMANKGTEKDGRPRLGGIGEYITHEIEKMTGIETRNTILGHIQRGGAPTGYDRVLATRLG
MGAVDMVAQKQWGKMVSVQGTEIKYVPLEEALDGLKSVPQERWDEAAVLFGR
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atgcgcagacatcaacaaggagccaatatgaagatcggtctgcttacttccggcggcgac
tgccccggcctgaacgctgtcatccgcggcgccgtgctcaacggtgtcaagaagtacggc
tacgaattcgtcggcttccgcgatggctggcgaggcgtcgttgaaggcgactacatggac
ctgccccgccagaaggtccgcggcctggcatcccagggcggcaccatcatcggtacctcc
cgcaccaaccccttcgacggccccaacggtggccccgaaaacatcgaaatcatgatggaa
cgccacggcatcgacgcaatcgtcgctatcggtggtgaaggcaccctcgcaggcgcaaag
cgtctggcagacgcaggcctgcccgtcatcggtgttcccaagaccatcgacaacgacctg
cgcgcaaccgactacaccttcggtttcgacaccgcagtgtccatcgcaaccgaggcaatg
gaccgcatccgcaccaccggtgaatcgcaccaccgctgcatggtcgccgaggtcatgggc
cgccacgtcggttggatcgcactgcactccggtatggctgcaggcgcacacgccatcctg
atccccgaggtcaaggtctccatggagcaggttgctgaatgggtcaaggaagtacacgac
cgcggccgctctcccctggttgttgttgctgagggcttcatccccgaaggcttcgacgac
gtcatggcaaacaagggtaccgagaaggacggtcgtccccgcctcggtggtatcggtgag
tacatcacccacgaaatcgagaagatgaccggcatcgaaacccgcaacaccatcctgggc
cacatccagcgcggtggcgcccccaccggctacgaccgcgtgctcgcaacccgcctgggc
atgggcgcagtcgacatggtcgctcagaagcagtggggcaagatggtctccgtgcagggc
accgagatcaagtacgtacccctcgaagaggcactggacggcctgaagtccgtacctcag
gaacgctgggacgaagcagccgttctcttcggccgctaa

DBGET integrated database retrieval system