KEGG   Rothia mucilaginosa: RMDY18_04230Help
Entry
RMDY18_04230      CDS       T01144                                 

Definition
(GenBank) 6-phosphofructokinase
  KO
K21071  ATP-dependent phosphofructokinase / diphosphate-dependent phosphofructokinase [EC:2.7.1.11 2.7.1.90]
Organism
rmu  Rothia mucilaginosa
Pathway
rmu00010  Glycolysis / Gluconeogenesis
rmu00030  Pentose phosphate pathway
rmu00051  Fructose and mannose metabolism
rmu00052  Galactose metabolism
rmu00680  Methane metabolism
rmu01100  Metabolic pathways
rmu01110  Biosynthesis of secondary metabolites
rmu01120  Microbial metabolism in diverse environments
rmu01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:rmu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RMDY18_04230
   00030 Pentose phosphate pathway
    RMDY18_04230
   00051 Fructose and mannose metabolism
    RMDY18_04230
   00052 Galactose metabolism
    RMDY18_04230
  Energy metabolism
   00680 Methane metabolism
    RMDY18_04230
Enzymes [BR:rmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     RMDY18_04230
    2.7.1.90  diphosphate---fructose-6-phosphate 1-phosphotransferase
     RMDY18_04230
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK NAD_kinase AIRC
Motif
Other DBs
NCBI-ProteinID: BAI64255
UniProt: D2NRH9
Position
complement(443174..444232)
Genome map
AA seq 352 aa AA seqDB search
MRRHQQGANMKIGLLTSGGDCPGLNAVIRGAVLNGVKKYGYEFVGFRDGWRGVVEGDYMD
LPRQKVRGLASQGGTIIGTSRTNPFDGPNGGPENIEIMMERHGIDAIVAIGGEGTLAGAK
RLADAGLPVIGVPKTIDNDLRATDYTFGFDTAVSIATEAMDRIRTTGESHHRCMVAEVMG
RHVGWIALHSGMAAGAHAILIPEVKVSMEQVAEWVKEVHDRGRSPLVVVAEGFIPEGFDD
VMANKGTEKDGRPRLGGIGEYITHEIEKMTGIETRNTILGHIQRGGAPTGYDRVLATRLG
MGAVDMVAQKQWGKMVSVQGTEIKYVPLEEALDGLKSVPQERWDEAAVLFGR
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atgcgcagacatcaacaaggagccaatatgaagatcggtctgcttacttccggcggcgac
tgccccggcctgaacgctgtcatccgcggcgccgtgctcaacggtgtcaagaagtacggc
tacgaattcgtcggcttccgcgatggctggcgaggcgtcgttgaaggcgactacatggac
ctgccccgccagaaggtccgcggcctggcatcccagggcggcaccatcatcggtacctcc
cgcaccaaccccttcgacggccccaacggtggccccgaaaacatcgaaatcatgatggaa
cgccacggcatcgacgcaatcgtcgctatcggtggtgaaggcaccctcgcaggcgcaaag
cgtctggcagacgcaggcctgcccgtcatcggtgttcccaagaccatcgacaacgacctg
cgcgcaaccgactacaccttcggtttcgacaccgcagtgtccatcgcaaccgaggcaatg
gaccgcatccgcaccaccggtgaatcgcaccaccgctgcatggtcgccgaggtcatgggc
cgccacgtcggttggatcgcactgcactccggtatggctgcaggcgcacacgccatcctg
atccccgaggtcaaggtctccatggagcaggttgctgaatgggtcaaggaagtacacgac
cgcggccgctctcccctggttgttgttgctgagggcttcatccccgaaggcttcgacgac
gtcatggcaaacaagggtaccgagaaggacggtcgtccccgcctcggtggtatcggtgag
tacatcacccacgaaatcgagaagatgaccggcatcgaaacccgcaacaccatcctgggc
cacatccagcgcggtggcgcccccaccggctacgaccgcgtgctcgcaacccgcctgggc
atgggcgcagtcgacatggtcgctcagaagcagtggggcaagatggtctccgtgcagggc
accgagatcaagtacgtacccctcgaagaggcactggacggcctgaagtccgtacctcag
gaacgctgggacgaagcagccgttctcttcggccgctaa

DBGET integrated database retrieval system