KEGG   Rothia mucilaginosa: RMDY18_06310Help
Entry
RMDY18_06310      CDS       T01144                                 

Definition
uroporphyrinogen-III synthase
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
rmu  Rothia mucilaginosa
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:rmu00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    RMDY18_06310
Enzymes [BR:rmu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     RMDY18_06310
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
652856..653794
Genome map
AA seq 312 aa AA seqDB search
MSASCSESRQADTPRTVLLTRSATQGAAFARALAEECTQNGLGEPRVLFAPLQQARTVKP
GADHAAALEALASGHYAWVSFTSANTVRACAELWGAEFARACASGGVHIACVGAATARAV
HAQLGLGTDFQPQVQSAAGMLVEFESPAPVDPTADSAATDSAAVLVLEGSNARPTLREGL
KNLGWDSRRCVLYDMVPAEQVAPGELSLAAARALVQGTAADAPAPETLAPETPAPETPAP
ETPAPDVLVVTAPSRLHALLDGAPALGPESMPPVVAIGASTASACRALNLRHVQADSPSP
QDLARAAASLIY
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atgtctgcctcgtgttctgaatcccggcaggctgataccccgcgcacggttctgctgacc
cgctccgccacccagggtgccgccttcgcacgcgccctcgccgaagaatgcacacagaac
gggttgggggagccccgggtcctcttcgctccgctacagcaggcacgcaccgtcaaaccg
ggcgcagaccacgccgccgcactggaggcgctcgcctccggtcactatgcgtgggtgagc
ttcacgagcgccaacacggttcgcgcctgcgccgagctgtggggtgcggagtttgcccgc
gcctgcgcgagcgggggagtgcacatcgcctgcgtgggggcggcaaccgcccgcgccgtg
cacgcccagctggggctgggcacggattttcaaccgcaggtgcagagtgccgccggtatg
ctcgtggagttcgagagccccgcccccgtagaccccacagctgattccgccgcgactgat
tcagccgccgtgctggttctggagggttccaacgcccgcccgaccctgcgcgaaggcctc
aaaaacctgggctgggacagccgccgctgcgtgctctacgacatggtgcccgccgagcag
gtggcacccggcgagctgagccttgccgccgcccgcgcgctcgtgcaggggactgccgca
gatgcccccgcgccggaaaccctcgccccggaaacccccgcgccggaaacccccgccccg
gaaacccccgcgccggatgtgctggtggtgaccgccccctcccgcttgcacgccctactc
gacggcgcacccgcgctaggacccgaatccatgccgccggtggtggcgattggggcgagt
accgcctccgcatgccgtgccctgaacctgcgccacgtgcaggcagattcgccctccccc
caggatttggcgcgcgccgctgcatccctcatttactaa

  All links  
No link information was found.   
DBGET integrated database retrieval system