KEGG   Rothia mucilaginosa: RMDY18_06320Help
Entry
RMDY18_06320      CDS       T01144                                 

Definition
delta-aminolevulinic acid dehydratase
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
rmu  Rothia mucilaginosa
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:rmu00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    RMDY18_06320
Enzymes [BR:rmu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     RMDY18_06320
Exosome [BR:rmu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   RMDY18_06320
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
653707..654831
Genome map
AA seq 374 aa AA seqDB search
MPCPEPAPRAGRFALPPGFGARRCIPHLLRPHIFIEFSGEIMNLTRRPRRLRTTAAMRSL
VAETTLRPSQLIQVFFVRDGITEPQPIRSMPGQYQHTLESIIPAVREAYEAGIRCIDLFG
IPRDEDKDEVGSTAWDPQGILNRAIAVCREEFGDDLVVMADTCLDEFTSHGHCGVLVDDG
HGTLVVDNDETVELYCKMAVSQARAGAHTVSPSGMMDGQIAAMRAALDEAGFEDVSILAY
SAKYASAFFGPFRDAVESTFKGDRKTYQQDPANRRESLLEVRADLEEGADMVMVKPAGSY
LDIVREVAEFSPVPVAAYQVSGEYAMIEAAAANGWIDRKAVVLESLRSIHRAGADVILTY
YGTEAAGWLRELDA
NT seq 1125 nt NT seq  +upstreamnt  +downstreamnt
atgccgtgccctgaacctgcgccacgtgcaggcagattcgccctccccccaggatttggc
gcgcgccgctgcatccctcatttactaagaccacatatttttatcgagttttcaggagag
atcatgaacctcacccgccgccctcgccgtctgcgcaccaccgcagccatgcgctccctc
gtcgctgagaccaccctgcgcccctcgcagctgattcaggtgttcttcgtgcgcgacggt
atcaccgagccgcagccgattcgttccatgcccggccagtaccagcacaccctggagagc
atcatccccgccgtgcgtgaggcgtacgaggcgggcatccgctgcatcgacctgttcggt
attccccgcgatgaggataaggacgaggtcggctcgaccgcctgggatccgcagggcatc
ctgaaccgcgcgattgccgtgtgccgtgaggaattcggcgacgacctggtggtcatggct
gacacctgcctggacgagtttacgagccacggccactgcggcgtgctggtcgatgacggc
cacggcaccctcgtggtggataatgacgagactgtggagctgtactgcaagatggcggtt
tcgcaggctcgcgcgggtgcgcacacggtgtccccctcgggcatgatggacggccagatc
gcggcgatgcgtgccgccctggacgaggccggctttgaggatgtgtcgattctggcgtat
tcggcgaagtacgcttctgcgttcttcgggccgttccgtgacgcggtagagtcgaccttc
aagggcgaccgtaagacctaccagcaggatccggcgaaccgccgcgagtcgcttctggag
gtgcgcgctgacctggaggagggcgcggatatggtgatggtgaagcctgccggcagctat
ctggatattgtgcgtgaggtggcggagttttcgccggtgccggtggcggcgtatcaggtg
tcgggtgagtacgcgatgattgaggcggctgcggcgaacggctggattgaccgtaaggct
gtggtgctggagtcgctgcgctcgattcaccgcgccggtgcggacgtcatcctgacctat
tacggtacggaggcggcaggctggctccgcgagctggacgcctaa

DBGET integrated database retrieval system