KEGG   Rothia mucilaginosa: RMDY18_07280Help
Entry
RMDY18_07280      CDS       T01144                                 

Definition
pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide acyltransferase (E2) component
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
rmu  Rothia mucilaginosa
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:rmu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    RMDY18_07280
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    RMDY18_07280
  Amino acid metabolism
   00310 Lysine degradation
    RMDY18_07280
Enzymes [BR:rmu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     RMDY18_07280
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(772633..774450)
Genome map
AA seq 605 aa AA seqDB search
MPGVSAEQRPYPDARRRATTHTARIRVAAHIFLVQAFTRRTGKIMSHTVVLPALGESVTE
GTVTRWLVEVGDTIEVDAPLVEVSTDKVDTEVPSPVAGVVEQILVPEDEDVEVGAALAII
GDGSGAAAPAAPAAAEAPAAPAPVAEAPAAPAAPAAAPAAPAAGSASGTEVLLPALGESV
TEGTVTRWLKEVGEQVEVDEPLVEVSTDKVDTEVPSPVAGTLLEIRIPEDEDAEVGQVLA
IIGDASAAAAPAAPAAPAPVAEAPAAPAAPAAAPAAPAAPAAPAAPAAAEGEAYVTPLVR
KLAKDNGIDLSTVKGTGVGGRIRKQDVQAAIAAKGSAAPAAAAPAAAAAPAAGSAKAPHT
FEVSPKRGTVEKTARIRQVIAKRMRESLDISTQLTQVTEVDVTRIVQLRAKAKDGFAARE
GAKLTFLPFFVQASAEALQQHPALNASMTEDYKQITYHGSENIAIAVDTPKGLLVPVIKN
ASDLGIAGLAKAIGDLGGRARTGDISPEELSGSTFTITNIGSFGALFDTPIINQPNVAIL
GTGSIVKRPMVVKDVDGNDVIAIRSMCYLSLTYDHRVVDGADAGRFLHTLKTRLEEANFE
SELGL
NT seq 1818 nt NT seq  +upstreamnt  +downstreamnt
ttgccgggcgtatccgctgaacaacgcccctatccggatgcgcgtcgacgtgctacaacg
catacggcgcgcatccgggtcgccgctcacatttttctagttcaagcattcacaaggaga
acgggaaagattatgtcccacaccgtagtactgcccgcactgggcgagtccgtgaccgag
ggtaccgttacccgctggctcgttgaggtcggcgacaccattgaggttgacgcacccctg
gttgaggtttccaccgacaaggttgacaccgaggttccctcccccgtagcaggcgttgtt
gagcagattctcgtccccgaggacgaggacgtcgaggtcggcgctgctctggctatcatt
ggcgacggttccggcgctgctgctccggctgctcccgcagctgctgaggctcccgcagct
cccgctccggttgctgaggctcccgcagctcccgcagcacccgctgctgctccggctgct
cccgcagctggctccgcttccggcactgaggttctgctgcccgcactgggcgagtccgtc
accgagggcaccgttacccgctggctgaaggaagttggcgagcaggttgaggttgacgag
cccctggttgaggtttccaccgacaaggttgacaccgaggttccctcccccgtagcaggt
accctgctcgagatccgcatccccgaggatgaggacgcagaggttggccaggttctggct
atcattggcgacgcttccgctgctgctgcaccggctgctcccgcagctcccgctccggtt
gctgaggctcctgctgctcccgcagcacccgctgctgccccggctgcacccgcagctccc
gctgcacctgccgctccggcagctgctgagggcgaagcatacgtgaccccgctggtccgt
aagctcgctaaggacaacggcatcgacctgtccaccgtcaagggcaccggtgttggtggc
cgcatccgcaagcaggatgttcaggctgctatcgctgctaagggttccgctgctcccgcc
gctgctgctcccgctgcagctgctgctccggctgctggttccgcaaaggcaccgcacacc
ttcgaggtttcccccaagcgtggcaccgtcgagaagaccgcacgtatccgccaggttatt
gcaaagcgtatgcgtgagtccctggacatctccacccagctgacccaggtcaccgaggtt
gacgtgacccgcatcgttcagctgcgtgcaaaggctaaggacggcttcgctgctcgtgag
ggcgctaagctgaccttcctgcccttcttcgtccaggcatccgctgaggctctgcagcag
caccccgctctgaacgcttccatgaccgaagactacaagcagatcacttaccacggctcc
gagaacatcgctattgctgtggacacccccaagggtctgctggttccggtcatcaagaac
gcttctgacctgggcattgctggcctggcaaaggctattggcgacctgggtggccgtgca
cgtaccggcgacatctcccccgaggagctgtcgggttcgaccttcaccatcaccaacatt
ggttccttcggtgcactgttcgacaccccgatcatcaaccagccgaacgttgcaatcctc
ggcaccggttccatcgtgaagcgccccatggttgttaaggatgttgacggtaacgacgtt
atcgctatccgctccatgtgctacctgtccctcacctacgatcaccgcgtggtcgacggt
gcggacgctggtcgcttcctgcacaccctcaagacccgcctggaggaggcaaacttcgag
tctgagctgggcctctaa

DBGET integrated database retrieval system