KEGG   Rothia mucilaginosa: RMDY18_07280Help
Entry
RMDY18_07280      CDS       T01144                                 

Definition
pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide acyltransferase (E2) component
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
rmu  Rothia mucilaginosa
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:rmu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    RMDY18_07280
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    RMDY18_07280
  Amino acid metabolism
   00310 Lysine degradation
    RMDY18_07280
Enzymes [BR:rmu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     RMDY18_07280
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(772633..774450)
Genome map
AA seq 605 aa AA seqDB search
MPGVSAEQRPYPDARRRATTHTARIRVAAHIFLVQAFTRRTGKIMSHTVVLPALGESVTE
GTVTRWLVEVGDTIEVDAPLVEVSTDKVDTEVPSPVAGVVEQILVPEDEDVEVGAALAII
GDGSGAAAPAAPAAAEAPAAPAPVAEAPAAPAAPAAAPAAPAAGSASGTEVLLPALGESV
TEGTVTRWLKEVGEQVEVDEPLVEVSTDKVDTEVPSPVAGTLLEIRIPEDEDAEVGQVLA
IIGDASAAAAPAAPAAPAPVAEAPAAPAAPAAAPAAPAAPAAPAAPAAAEGEAYVTPLVR
KLAKDNGIDLSTVKGTGVGGRIRKQDVQAAIAAKGSAAPAAAAPAAAAAPAAGSAKAPHT
FEVSPKRGTVEKTARIRQVIAKRMRESLDISTQLTQVTEVDVTRIVQLRAKAKDGFAARE
GAKLTFLPFFVQASAEALQQHPALNASMTEDYKQITYHGSENIAIAVDTPKGLLVPVIKN
ASDLGIAGLAKAIGDLGGRARTGDISPEELSGSTFTITNIGSFGALFDTPIINQPNVAIL
GTGSIVKRPMVVKDVDGNDVIAIRSMCYLSLTYDHRVVDGADAGRFLHTLKTRLEEANFE
SELGL
NT seq 1818 nt NT seq  +upstreamnt  +downstreamnt
ttgccgggcgtatccgctgaacaacgcccctatccggatgcgcgtcgacgtgctacaacg
catacggcgcgcatccgggtcgccgctcacatttttctagttcaagcattcacaaggaga
acgggaaagattatgtcccacaccgtagtactgcccgcactgggcgagtccgtgaccgag
ggtaccgttacccgctggctcgttgaggtcggcgacaccattgaggttgacgcacccctg
gttgaggtttccaccgacaaggttgacaccgaggttccctcccccgtagcaggcgttgtt
gagcagattctcgtccccgaggacgaggacgtcgaggtcggcgctgctctggctatcatt
ggcgacggttccggcgctgctgctccggctgctcccgcagctgctgaggctcccgcagct
cccgctccggttgctgaggctcccgcagctcccgcagcacccgctgctgctccggctgct
cccgcagctggctccgcttccggcactgaggttctgctgcccgcactgggcgagtccgtc
accgagggcaccgttacccgctggctgaaggaagttggcgagcaggttgaggttgacgag
cccctggttgaggtttccaccgacaaggttgacaccgaggttccctcccccgtagcaggt
accctgctcgagatccgcatccccgaggatgaggacgcagaggttggccaggttctggct
atcattggcgacgcttccgctgctgctgcaccggctgctcccgcagctcccgctccggtt
gctgaggctcctgctgctcccgcagcacccgctgctgccccggctgcacccgcagctccc
gctgcacctgccgctccggcagctgctgagggcgaagcatacgtgaccccgctggtccgt
aagctcgctaaggacaacggcatcgacctgtccaccgtcaagggcaccggtgttggtggc
cgcatccgcaagcaggatgttcaggctgctatcgctgctaagggttccgctgctcccgcc
gctgctgctcccgctgcagctgctgctccggctgctggttccgcaaaggcaccgcacacc
ttcgaggtttcccccaagcgtggcaccgtcgagaagaccgcacgtatccgccaggttatt
gcaaagcgtatgcgtgagtccctggacatctccacccagctgacccaggtcaccgaggtt
gacgtgacccgcatcgttcagctgcgtgcaaaggctaaggacggcttcgctgctcgtgag
ggcgctaagctgaccttcctgcccttcttcgtccaggcatccgctgaggctctgcagcag
caccccgctctgaacgcttccatgaccgaagactacaagcagatcacttaccacggctcc
gagaacatcgctattgctgtggacacccccaagggtctgctggttccggtcatcaagaac
gcttctgacctgggcattgctggcctggcaaaggctattggcgacctgggtggccgtgca
cgtaccggcgacatctcccccgaggagctgtcgggttcgaccttcaccatcaccaacatt
ggttccttcggtgcactgttcgacaccccgatcatcaaccagccgaacgttgcaatcctc
ggcaccggttccatcgtgaagcgccccatggttgttaaggatgttgacggtaacgacgtt
atcgctatccgctccatgtgctacctgtccctcacctacgatcaccgcgtggtcgacggt
gcggacgctggtcgcttcctgcacaccctcaagacccgcctggaggaggcaaacttcgag
tctgagctgggcctctaa

DBGET integrated database retrieval system