KEGG   Rothia mucilaginosa: RMDY18_07700Help
Entry
RMDY18_07700      CDS       T01144                                 

Definition
glutamyl- and glutaminyl-tRNA synthetase
Orthology
K01885  
glutamyl-tRNA synthetase [EC:6.1.1.17]
Organism
rmu  Rothia mucilaginosa
Pathway
Porphyrin and chlorophyll metabolism
Aminoacyl-tRNA biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Aminoacyl-tRNA biosynthesis, prokaryotes
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:rmu00860]
Genetic Information Processing; Translation; Aminoacyl-tRNA biosynthesis [PATH:rmu00970]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
821810..823321
Genome map
AA seq 503 aa AA seqDB search
MTEYHGPVLNSPADTRVRFCPSPTGTPHVGMVRTALFNWAYARHTGGKLIFRIEDTDAAR
DSEESFNQVLESLHWLGINWDEGVGVGGPHEPYRQSERKTAGIYNEIFEKLVEGGYVYED
FSTPDEVKERRKAAGQDPQLGYDNYDRNLTEEQKEAYRAEGRQPVWRLRMPDEDITFNDL
VRGEITFKAGTVPDYVVVRSNGDPLYTFVNPVDDALMGITHVLRGEDLLSSTPRQIALYR
ALIDTGVTSFIPEFGHLPYVMGQGNKKLSKRDPESNLFLLRDSGFIKEGLLNYLSLLGWS
LSADQDVFSIDELVEHFDVHDVVANPARFDVKKAESINGDHIRALDPKDFRDRLVPYLQA
AGVLGETLTEREEQILTEAAPLVQERMQLLGEAPGLLAFLFKADEEISTADDARKQLKES
APQVLAAAIEALEPLEDFTAANIEAALRAAIVDGLEIKPRLAFGPVRIAVSGERISPPLF
ESMEILGKESSLARLRKLAAELS
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
atgaccgaataccacggtcccgtactcaacagccctgcagacacccgcgtccgcttctgc
ccctcgcccaccggtaccccgcacgtgggcatggtccgcaccgccctcttcaactgggcg
tacgcacgccacaccggcggcaagctgatcttccgcatcgaagacaccgacgcagcacgc
gactccgaagagtcgttcaaccaggtgctcgaatccctgcactggctcggcatcaactgg
gacgaaggcgttggcgtcggcggcccccacgagccctaccgccagtccgagcgtaagacc
gcaggcatctacaacgagatcttcgaaaagctcgttgaaggcggctacgtgtacgaagac
ttctccacccccgacgaggtgaaggaacgccgcaaggcagccggtcaggacccgcagctc
ggctacgacaactacgaccgcaacctcaccgaagagcagaaggaagcctaccgcgccgag
ggccgccagcccgtgtggcgtctgcgcatgcccgacgaagacatcaccttcaacgacctc
gttcgcggtgaaatcacctttaaggcaggcaccgtacccgactacgtggtcgtccgctcc
aacggcgacccgctgtacaccttcgtgaaccccgtcgacgacgcactcatgggcatcacc
cacgtgctgcgcggcgaagacctgctctcctccaccccgcgtcagattgcgctctaccgc
gcgctcatcgacaccggcgtgaccagcttcatccccgaattcggccacctgccctacgtc
atgggccagggcaacaagaagctctccaagcgcgaccccgagtcgaacctcttcctgctg
cgcgactccggcttcatcaaggaaggcctgctgaactacctgtccctgctgggctggtcc
ctctccgcagaccaggacgtcttcagcatcgacgagctcgtcgagcacttcgacgtacac
gacgttgtcgccaaccccgcacgcttcgacgtgaagaaggcagagtccatcaacggcgac
cacatccgtgcgctcgaccccaaggacttccgcgaccgcctcgtgccgtacctgcaggct
gcaggcgtactcggcgaaaccctcaccgagcgcgaagagcagatcctcaccgaagctgca
cccctcgtccaggagcgcatgcagttgctcggcgaagcacccggcctgctcgcattcctc
ttcaaggctgacgaagaaatcagcaccgcagacgacgcacgcaagcagctcaaggaatcc
gcaccgcaggtcctcgccgccgctatcgaggctctggagcccctcgaggacttcaccgca
gccaacattgaggcagctctgcgcgccgcaatcgtcgacggcctggaaatcaagccgcgc
ctcgcattcggccccgtgcgcatcgcagtgtccggtgagcgcatctccccgcccttgttc
gaatccatggaaatcctgggcaaggaatcctccctcgcacgcctgcgcaagcttgccgct
gaactgagctaa

DBGET integrated database retrieval system