KEGG   Rothia mucilaginosa: RMDY18_08100Help
Entry
RMDY18_08100      CDS       T01144                                 

Definition
UDP-N-acetylglucosamine enolpyruvyl transferase
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
rmu  Rothia mucilaginosa
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:rmu00520]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:rmu00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
871329..872762
Genome map
AA seq 477 aa AA seqDB search
MTENISKLRIEGGTPLVGEVHVRGAKNLVPKAMVAALHGSTPSTLRNVPDLSDVEIVTTL
VELHGAKVDYDRDAGVLTLNPAQDATTAAKNAEEIQLFGGNSRIPILMVGPLLHTLGTAR
IPNLGGCKIGDRPIDYHMAALRKFGAVVEKDDETGTTLIVPEEGLKGAEIVLNYPSVGAT
EQVLLTGVRAKGKTILRNAAIEPEIIDLIAVLQKMGAIIFINEDRTIVIEGVDELTGYDH
TSLPDRNESASWASAALATGGDIFVRGADQKDMTAFLNQFRKMGGLYEVTAEGIRFTHPA
QHTPGAQLKPIVFETNVHPGFMTDWQQPLVVALTQAKGASIVHETVYEERFGFTNALKQM
GADIVVMRDCVGGAPCRFEGKGYGHSAIISGPTPLTGADIEVPDLRGGFSHIIAALAAKG
TSHVSGVELIARGYENFEEKLKSLGANFEVLARKASKAPKPDAAIVVVEPEEVEVQD
NT seq 1434 nt NT seq  +upstreamnt  +downstreamnt
atgactgagaacatcagcaagcttcgcattgaaggtggcactccgctcgttggtgaggtt
cacgttcgaggcgccaagaacctggtgcccaaggcgatggtcgcagcactgcatggttcg
accccctcgaccctgcgtaacgtccctgacctgagcgatgtcgaaatcgttaccaccctc
gtggagctgcacggtgcaaaggtcgactatgaccgcgacgctggtgttctgactctcaac
cccgcacaggatgcaaccaccgctgcaaagaacgcagaggagattcagctcttcggtggt
aactcccgcatcccgattctgatggtgggcccgctgctacacaccctcggtaccgcacgc
atccccaacctgggtggttgcaagattggtgaccgccccatcgactaccatatggcggct
ctgcgcaagttcggtgcagtcgttgaaaaggatgatgaaaccggcaccactctgattgtt
cccgaagagggtctgaagggcgcagagattgtgctgaactacccctccgtgggtgctacc
gagcaggttctgctcaccggtgtgcgcgctaagggtaagaccatcctgcgcaatgcagcg
attgagcccgaaattattgacctgattgctgttctgcagaagatgggcgccatcatcttc
attaacgaggaccgcaccatcgtcattgagggcgtggacgagctgaccggctacgatcac
acgtccctgcccgaccgtaacgagtccgcttcctgggcttctgcagctctggctaccggc
ggcgacattttcgtgcgcggcgcagatcagaaggatatgaccgcgttcctgaaccagttc
cgcaagatgggtggcctgtacgaggtgaccgccgaaggtatccgcttcacccacccggct
cagcacacccccggtgctcagctgaagcccatcgtctttgagaccaacgtgcaccccggc
ttcatgaccgactggcagcagccccttgtcgtggcgctgacccaggctaagggcgcatcc
atcgtgcacgagaccgtgtacgaggagcgtttcggcttcaccaacgccctgaagcagatg
ggcgcagatattgtcgtcatgcgtgattgcgtgggcggcgcaccctgccgtttcgagggt
aagggctacggccactccgctattatttctggtcccaccccgctgaccggtgccgacatt
gaggttccggacctgcgcggcggcttctcccacatcattgctgctctggccgctaagggc
acctctcacgtgagtggtgttgagctgattgctcgcggctacgagaactttgaggagaag
ctcaagagcctgggtgccaactttgaggtgctggcacgcaaggcgtcgaaggctcccaag
cccgatgcggcaatcgtcgttgttgagcccgaggaagttgaggttcaggactag

DBGET integrated database retrieval system