KEGG   Rothia mucilaginosa: RMDY18_08280Help
Entry
RMDY18_08280      CDS       T01144                                 

Definition
(GenBank) tryptophan synthase beta chain
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
rmu  Rothia mucilaginosa
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:rmu00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    RMDY18_08280
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    RMDY18_08280
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    RMDY18_08280
Enzymes [BR:rmu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     RMDY18_08280
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
898835..900172
Genome map
AA seq 445 aa AA seqDB search
MMSENLADAFLNGESLKNAPGPYFGEYGGRWMPESLIAAMDELEATFNEAKNDPEFIAEF
QRLSAEYSNRPSLLTEVPKFSEHAGARVFLKREDLNHTGSHKINNVIGQALLAKRMGKTR
LIAETGAGQHGVATATAAALFGMECVVYMGEEDTERQSLNVARMQLLGAKVIAVQNGSRT
LKDAINEALRDWVSNVENTHYLLGTAAGAHPFPAMVRFFHDAIGEEAREQILAETGRLPD
GIAACVGGGSNAIGLFHAFLDDSSVEIYGFEAGGDGVETGRHAATITLGRPGMLHGAMTY
LMQDEDGQTIESHSISAGLDYPGVGPEHSYLSDIGRVTYEPVTDTEAMDALRLLCRTEGI
IPAIESSHALAGALRVCQRWVAEDPEAAREKTMIVCLSGRGDKDMETALKWFGLGKAIPS
STLMTGNKEAAASAAQNAQAESEAK
NT seq 1338 nt NT seq  +upstreamnt  +downstreamnt
gtgatgagcgagaacctggcagatgctttcctcaacggcgagtcgttgaagaatgccccc
ggcccctattttggtgagtacggcgggcggtggatgcccgagtcactgattgccgccatg
gatgagctggaggcaacctttaacgaggcgaagaacgaccccgagttcattgctgagttc
cagcgtctttctgctgagtattcgaaccgtccgtcgttgctgactgaggttccgaagttc
tctgagcatgctggtgcgcgtgtgttcctcaagcgtgaggacctgaaccacacgggtagc
cacaagattaataacgtgattggccaggctctgctggctaagcgtatgggtaagacccgt
ctgattgctgagaccggtgcgggtcagcacggtgttgcgactgcgactgcggctgcgctg
tttggcatggagtgcgtggtctacatgggtgaggaagacactgagcgtcagtcgctgaac
gtggctcgtatgcagctgctgggcgcgaaggtgattgcggttcagaacggttcccgcacc
ctcaaggacgccattaatgaggcgctgcgcgactgggtttcgaacgttgagaacacccac
tacctgctgggtaccgctgcgggtgcgcacccgttcccggcgatggtgcgtttcttccac
gacgctatcggtgaggaggcgcgcgagcagattcttgctgagactggccgcctgcccgat
ggtattgctgcctgcgtgggtggcggttcgaacgcgattggtctgttccacgcgttcttg
gacgattcttcggttgagatttacggttttgaggctggcggtgacggcgtggagaccggc
cgtcacgcggcgaccattactctgggccgcccgggcatgctgcacggcgcgatgacctac
ctgatgcaggatgaggacggccagaccattgagtcccattcgatttctgctggtctggat
tacccgggtgtgggtcctgagcactcctacctgtccgatattggtcgcgtgacttacgag
ccggtgactgacaccgaggcgatggacgctctgcgtctgctctgccgcaccgagggtatt
atcccggcgattgagtcctcgcacgctctggcgggcgcgttgcgcgtgtgccagcgttgg
gttgctgaggatccggaggcggcacgtgagaagacgatgattgtctgcctgtcgggtcgt
ggcgataaggacatggagaccgcgctgaagtggttcggtctgggtaaggcgattccgtcc
tcgaccctgatgaccggtaataaggaagctgccgcatccgctgcacagaacgcacaggct
gaaagtgaggctaagtaa

DBGET integrated database retrieval system