KEGG   Rothia mucilaginosa: RMDY18_08290Help
Entry
RMDY18_08290      CDS       T01144                                 

Definition
(GenBank) tryptophan synthase alpha chain
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
rmu  Rothia mucilaginosa
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:rmu00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    RMDY18_08290
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    RMDY18_08290
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    RMDY18_08290
Enzymes [BR:rmu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     RMDY18_08290
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
900172..901026
Genome map
AA seq 284 aa AA seqDB search
MSYQDAISQAAPFTVLDGSFPAPNAQSPLAARLAECEKQGRAALIGYLPVGFPTLDESID
AAIALGNNGADIIELGVPYSDPVMDGPVIQKATGVALENGFKLPQLFEAVRRITEATDAV
VVVMTYWNPVLAYGVKNFARDLAAAGGAGMITPDLVPDEASSWFEASDEYGLDRIFLAAL
SSSPERLATIAKASSGFVYAVSVMGVTGARTSVSEAARTLVADIKAAGAPRACVGLGVST
RAHVEEIGEYADGVIVGTALVKALASGGVEAVAKLTRELAGREG
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
atgagctaccaggacgctatttctcaggcggcaccttttacggtgctggatggttctttc
cccgctccgaatgcgcagtcgcctctggcggctcgtctggctgagtgcgagaagcagggc
cgtgcggcgctgattggctacctgccggtgggcttcccgaccctggacgagtcgattgac
gcggcgattgctctgggcaataacggcgcggacattattgagctgggcgtgccttattct
gatccggtcatggatggcccggtgattcagaaggctaccggcgtggcgctggagaacggt
ttcaagcttcctcagctgtttgaggcggtccgccgcattaccgaggcgaccgacgcggtg
gttgtcgtgatgacgtactggaacccggttctggcgtacggtgtgaagaattttgcgcgt
gatttggcggctgccggcggtgcgggcatgattaccccggacctggtgcctgatgaggcg
tcgtcgtggtttgaagcttctgatgagtacggtctggaccgtattttcttggctgctctg
tcttcttcgccggagcgtctggcgactattgcgaaggcgtcgagcggcttcgtgtacgcc
gtgtcggtgatgggcgtgaccggtgcccgcacctccgtgtcggaggcggctcgcaccctg
gttgcggacattaaggctgccggtgcgcctcgtgcgtgcgtgggtctgggcgtttcgact
cgtgcccacgttgaggagattggcgagtatgcggacggcgtgattgtcggtactgcgcta
gtgaaggctttggcttctggcggtgttgaggcggtggctaagctgacccgtgagctggcg
gggcgtgaaggctaa

DBGET integrated database retrieval system