KEGG   Rothia mucilaginosa: RMDY18_08290Help
Entry
RMDY18_08290      CDS       T01144                                 

Definition
tryptophan synthase alpha chain
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
rmu  Rothia mucilaginosa
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:rmu00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    RMDY18_08290
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    RMDY18_08290
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    RMDY18_08290
Enzymes [BR:rmu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     RMDY18_08290
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
900172..901026
Genome map
AA seq 284 aa AA seqDB search
MSYQDAISQAAPFTVLDGSFPAPNAQSPLAARLAECEKQGRAALIGYLPVGFPTLDESID
AAIALGNNGADIIELGVPYSDPVMDGPVIQKATGVALENGFKLPQLFEAVRRITEATDAV
VVVMTYWNPVLAYGVKNFARDLAAAGGAGMITPDLVPDEASSWFEASDEYGLDRIFLAAL
SSSPERLATIAKASSGFVYAVSVMGVTGARTSVSEAARTLVADIKAAGAPRACVGLGVST
RAHVEEIGEYADGVIVGTALVKALASGGVEAVAKLTRELAGREG
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
atgagctaccaggacgctatttctcaggcggcaccttttacggtgctggatggttctttc
cccgctccgaatgcgcagtcgcctctggcggctcgtctggctgagtgcgagaagcagggc
cgtgcggcgctgattggctacctgccggtgggcttcccgaccctggacgagtcgattgac
gcggcgattgctctgggcaataacggcgcggacattattgagctgggcgtgccttattct
gatccggtcatggatggcccggtgattcagaaggctaccggcgtggcgctggagaacggt
ttcaagcttcctcagctgtttgaggcggtccgccgcattaccgaggcgaccgacgcggtg
gttgtcgtgatgacgtactggaacccggttctggcgtacggtgtgaagaattttgcgcgt
gatttggcggctgccggcggtgcgggcatgattaccccggacctggtgcctgatgaggcg
tcgtcgtggtttgaagcttctgatgagtacggtctggaccgtattttcttggctgctctg
tcttcttcgccggagcgtctggcgactattgcgaaggcgtcgagcggcttcgtgtacgcc
gtgtcggtgatgggcgtgaccggtgcccgcacctccgtgtcggaggcggctcgcaccctg
gttgcggacattaaggctgccggtgcgcctcgtgcgtgcgtgggtctgggcgtttcgact
cgtgcccacgttgaggagattggcgagtatgcggacggcgtgattgtcggtactgcgcta
gtgaaggctttggcttctggcggtgttgaggcggtggctaagctgacccgtgagctggcg
gggcgtgaaggctaa

DBGET integrated database retrieval system