KEGG   Rothia mucilaginosa: RMDY18_08290Help
Entry
RMDY18_08290      CDS       T01144                                 

Definition
(GenBank) tryptophan synthase alpha chain
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
rmu  Rothia mucilaginosa
Pathway
rmu00260  Glycine, serine and threonine metabolism
rmu00400  Phenylalanine, tyrosine and tryptophan biosynthesis
rmu01100  Metabolic pathways
rmu01110  Biosynthesis of secondary metabolites
rmu01130  Biosynthesis of antibiotics
rmu01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:rmu00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    RMDY18_08290
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    RMDY18_08290
Enzymes [BR:rmu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     RMDY18_08290
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA BtpA
Motif
Other DBs
NCBI-ProteinID: BAI64661
UniProt: D2NSN5
Position
900172..901026
Genome map
AA seq 284 aa AA seqDB search
MSYQDAISQAAPFTVLDGSFPAPNAQSPLAARLAECEKQGRAALIGYLPVGFPTLDESID
AAIALGNNGADIIELGVPYSDPVMDGPVIQKATGVALENGFKLPQLFEAVRRITEATDAV
VVVMTYWNPVLAYGVKNFARDLAAAGGAGMITPDLVPDEASSWFEASDEYGLDRIFLAAL
SSSPERLATIAKASSGFVYAVSVMGVTGARTSVSEAARTLVADIKAAGAPRACVGLGVST
RAHVEEIGEYADGVIVGTALVKALASGGVEAVAKLTRELAGREG
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
atgagctaccaggacgctatttctcaggcggcaccttttacggtgctggatggttctttc
cccgctccgaatgcgcagtcgcctctggcggctcgtctggctgagtgcgagaagcagggc
cgtgcggcgctgattggctacctgccggtgggcttcccgaccctggacgagtcgattgac
gcggcgattgctctgggcaataacggcgcggacattattgagctgggcgtgccttattct
gatccggtcatggatggcccggtgattcagaaggctaccggcgtggcgctggagaacggt
ttcaagcttcctcagctgtttgaggcggtccgccgcattaccgaggcgaccgacgcggtg
gttgtcgtgatgacgtactggaacccggttctggcgtacggtgtgaagaattttgcgcgt
gatttggcggctgccggcggtgcgggcatgattaccccggacctggtgcctgatgaggcg
tcgtcgtggtttgaagcttctgatgagtacggtctggaccgtattttcttggctgctctg
tcttcttcgccggagcgtctggcgactattgcgaaggcgtcgagcggcttcgtgtacgcc
gtgtcggtgatgggcgtgaccggtgcccgcacctccgtgtcggaggcggctcgcaccctg
gttgcggacattaaggctgccggtgcgcctcgtgcgtgcgtgggtctgggcgtttcgact
cgtgcccacgttgaggagattggcgagtatgcggacggcgtgattgtcggtactgcgcta
gtgaaggctttggcttctggcggtgttgaggcggtggctaagctgacccgtgagctggcg
gggcgtgaaggctaa

DBGET integrated database retrieval system