KEGG   Rothia mucilaginosa: RMDY18_08320Help
Entry
RMDY18_08320      CDS       T01144                                 

Definition
(GenBank) Zn-dependent alcohol dehydrogenase
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
rmu  Rothia mucilaginosa
Pathway
rmu00010  Glycolysis / Gluconeogenesis
rmu00071  Fatty acid degradation
rmu00350  Tyrosine metabolism
rmu00625  Chloroalkane and chloroalkene degradation
rmu00626  Naphthalene degradation
rmu01100  Metabolic pathways
rmu01110  Biosynthesis of secondary metabolites
rmu01120  Microbial metabolism in diverse environments
rmu01130  Biosynthesis of antibiotics
rmu01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:rmu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RMDY18_08320
  Lipid metabolism
   00071 Fatty acid degradation
    RMDY18_08320
  Amino acid metabolism
   00350 Tyrosine metabolism
    RMDY18_08320
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    RMDY18_08320
   00626 Naphthalene degradation
    RMDY18_08320
Enzymes [BR:rmu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     RMDY18_08320
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_zinc_N ADH_N ADH_zinc_N_2 Methyltransf_25 TrkA_N Methyltransf_31
Motif
Other DBs
NCBI-ProteinID: BAI64664
UniProt: D2NSN8
Position
904183..905223
Genome map
AA seq 346 aa AA seqDB search
MCKETMKAVVVPEKVDGSVVVREVPVPAVGHGQALVKIEYSGVCHTDLHVASGDFGEVPG
RILGHEGIGRVVKVGEGVESLKEGDRVSVAWFFEGCGHCEYCTSGRETLCRSVKNAGYSV
DGGMSEYTLVTADYAVKVPEGLDPAQASSITCAGVTTYKAIKESLVRPGQWLVAYGAGGL
GNLAVQYAKKVFGAKVIAVDINDDKLALARETGADHVINGREVEDVPARIRELTGGGAHA
AVVTAVSKVAFNQAVESVRAGGSVVAVGLPSEMMELSIVKIILDGIRVVGSLVGTRQDLA
EAFQFGADGIVVPVVQLREVDEAPAVFEEMAAGKITGRMVLDFASL
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgtgcaaggaaaccatgaaggctgttgttgtccctgagaaggttgacggttcggttgtt
gtccgtgaggttcccgttccggctgtcggtcacggccaggcgctcgtgaagattgagtac
tcgggcgtgtgccacactgacctgcacgtggcttccggtgacttcggtgaggttccgggt
cgtattctgggccacgaaggcattggtcgtgtcgtcaaggtcggtgagggtgttgagtcc
ctgaaggaaggcgatcgcgtgtcggtggcttggttcttcgagggctgcggccactgtgag
tactgcacctcgggccgtgagaccctgtgccgttcggtgaagaatgcaggctactcggtc
gatggcggcatgagtgagtacactctggtgaccgctgattacgctgtgaaggttcccgag
ggtcttgacccggcacaggcaagctccattacctgcgctggtgtgaccacctacaaggca
atcaaggagtcgctggttcgcccgggtcagtggctggttgcttacggcgctggcggtctg
ggtaacctggctgttcagtacgctaagaaggttttcggcgccaaggttattgctgttgat
atcaacgacgacaagctggctctggctcgtgagaccggtgctgatcacgtcatcaacggc
cgtgaggttgaggatgttccggctcgtattcgcgagctgaccggcggcggcgctcacgct
gctgtggtgaccgcggtgtcgaaggttgcgttcaaccaggctgttgagtcggttcgcgca
ggcggttccgtggtggctgttggcctgccttcggagatgatggagctgtccattgtgaag
attattctggacggcatccgcgtggtgggctccctggtgggtacccgtcaggatctggcg
gaggcgttccagttcggtgctgacggcatcgtggttccggtggttcagttgcgtgaggtt
gacgaggcaccggctgtcttcgaggaaatggcggcgggtaagattaccggccgtatggtt
ctggacttcgctagcctctaa

DBGET integrated database retrieval system