KEGG   Rothia mucilaginosa: RMDY18_08610Help
Entry
RMDY18_08610      CDS       T01144                                 

Definition
(GenBank) ribose 5-phosphate isomerase RpiB
  KO
K01808  ribose 5-phosphate isomerase B [EC:5.3.1.6]
Organism
rmu  Rothia mucilaginosa
Pathway
rmu00030  Pentose phosphate pathway
rmu00051  Fructose and mannose metabolism
rmu01100  Metabolic pathways
rmu01110  Biosynthesis of secondary metabolites
rmu01120  Microbial metabolism in diverse environments
rmu01130  Biosynthesis of antibiotics
rmu01200  Carbon metabolism
rmu01230  Biosynthesis of amino acids
Module
rmu_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
rmu_M00007  Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
Brite
KEGG Orthology (KO) [BR:rmu00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    RMDY18_08610
   00051 Fructose and mannose metabolism
    RMDY18_08610
Enzymes [BR:rmu01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.6  ribose-5-phosphate isomerase
     RMDY18_08610
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LacAB_rpiB
Motif
Other DBs
NCBI-ProteinID: BAI64693
UniProt: D2NSR7
Position
931201..931692
Genome map
AA seq 163 aa AA seqDB search
MRVHIATDHAGLELSHYLIESLTAAGYEMIDHGPADYDPLDDYPSFCINAALGVKRDREA
GLDSLGIVLGGSGNGEQMAANKVDGIRAALAWNHDTAALAREHNNAQVVAVGGRQHSKEE
ALEIIKVFLATPWTNEERHARRIGQLAEYEQTGDIAGKQIDAA
NT seq 492 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgtacacatcgcaaccgaccacgctggcctcgaactgagccactacctgatcgag
tccctcaccgctgcgggctacgaaatgattgaccacggccccgccgactacgacccgctg
gacgactacccctcgttctgcattaacgcagcccttggcgtgaagcgtgaccgcgaggct
ggcctggactccctgggtatcgtgctgggcggtagcggcaacggcgagcagatggcggcg
aacaaggttgatggtatccgcgcagctctggcatggaaccacgacaccgcggcactggct
cgcgagcacaacaacgcacaggttgtagctgtgggcggccgccagcacagcaaggaagaa
gcactggaaatcatcaaggtcttcctggctaccccctggaccaacgaggagcgtcacgca
cgccgtatcggccagctggctgagtacgagcagaccggcgacattgccggcaagcagatt
gacgctgcctaa

DBGET integrated database retrieval system