KEGG   Rothia mucilaginosa: RMDY18_08610Help
Entry
RMDY18_08610      CDS       T01144                                 

Definition
ribose 5-phosphate isomerase RpiB
Orthology
K01808  
ribose 5-phosphate isomerase B [EC:5.3.1.6]
Organism
rmu  Rothia mucilaginosa
Pathway
Pentose phosphate pathway
Fructose and mannose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Pentose phosphate pathway (Pentose phosphate cycle)
Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
Brite
KEGG Orthology (KO) [BR:rmu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    RMDY18_08610
   01230 Biosynthesis of amino acids
    RMDY18_08610
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    RMDY18_08610
   00051 Fructose and mannose metabolism
    RMDY18_08610
Enzymes [BR:rmu01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.6  ribose-5-phosphate isomerase
     RMDY18_08610
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
931201..931692
Genome map
AA seq 163 aa AA seqDB search
MRVHIATDHAGLELSHYLIESLTAAGYEMIDHGPADYDPLDDYPSFCINAALGVKRDREA
GLDSLGIVLGGSGNGEQMAANKVDGIRAALAWNHDTAALAREHNNAQVVAVGGRQHSKEE
ALEIIKVFLATPWTNEERHARRIGQLAEYEQTGDIAGKQIDAA
NT seq 492 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgtacacatcgcaaccgaccacgctggcctcgaactgagccactacctgatcgag
tccctcaccgctgcgggctacgaaatgattgaccacggccccgccgactacgacccgctg
gacgactacccctcgttctgcattaacgcagcccttggcgtgaagcgtgaccgcgaggct
ggcctggactccctgggtatcgtgctgggcggtagcggcaacggcgagcagatggcggcg
aacaaggttgatggtatccgcgcagctctggcatggaaccacgacaccgcggcactggct
cgcgagcacaacaacgcacaggttgtagctgtgggcggccgccagcacagcaaggaagaa
gcactggaaatcatcaaggtcttcctggctaccccctggaccaacgaggagcgtcacgca
cgccgtatcggccagctggctgagtacgagcagaccggcgacattgccggcaagcagatt
gacgctgcctaa

DBGET integrated database retrieval system