KEGG   Rothia mucilaginosa: RMDY18_08610Help
Entry
RMDY18_08610      CDS       T01144                                 

Definition
ribose 5-phosphate isomerase RpiB
Orthology
K01808  
ribose 5-phosphate isomerase B [EC:5.3.1.6]
Organism
rmu  Rothia mucilaginosa
Pathway
Pentose phosphate pathway
Fructose and mannose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Pentose phosphate pathway (Pentose phosphate cycle)
Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
Class
Metabolism; Overview; Carbon metabolism [PATH:rmu01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:rmu01230]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:rmu00030]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:rmu00051]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
931201..931692
Genome map
AA seq 163 aa AA seqDB search
MRVHIATDHAGLELSHYLIESLTAAGYEMIDHGPADYDPLDDYPSFCINAALGVKRDREA
GLDSLGIVLGGSGNGEQMAANKVDGIRAALAWNHDTAALAREHNNAQVVAVGGRQHSKEE
ALEIIKVFLATPWTNEERHARRIGQLAEYEQTGDIAGKQIDAA
NT seq 492 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgtacacatcgcaaccgaccacgctggcctcgaactgagccactacctgatcgag
tccctcaccgctgcgggctacgaaatgattgaccacggccccgccgactacgacccgctg
gacgactacccctcgttctgcattaacgcagcccttggcgtgaagcgtgaccgcgaggct
ggcctggactccctgggtatcgtgctgggcggtagcggcaacggcgagcagatggcggcg
aacaaggttgatggtatccgcgcagctctggcatggaaccacgacaccgcggcactggct
cgcgagcacaacaacgcacaggttgtagctgtgggcggccgccagcacagcaaggaagaa
gcactggaaatcatcaaggtcttcctggctaccccctggaccaacgaggagcgtcacgca
cgccgtatcggccagctggctgagtacgagcagaccggcgacattgccggcaagcagatt
gacgctgcctaa

DBGET integrated database retrieval system