KEGG   Rothia mucilaginosa: RMDY18_09270Help
Entry
RMDY18_09270      CDS       T01144                                 

Definition
(GenBank) beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidase
  KO
K01223  6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
rmu  Rothia mucilaginosa
Pathway
rmu00010  Glycolysis / Gluconeogenesis
rmu00500  Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:rmu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RMDY18_09270
   00500 Starch and sucrose metabolism
    RMDY18_09270
Enzymes [BR:rmu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     RMDY18_09270
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_1 Cellulase Glyco_hydro_42
Motif
Other DBs
NCBI-ProteinID: BAI64759
UniProt: D2NSY3
Position
complement(1011471..1012964)
Genome map
AA seq 497 aa AA seqDB search
MEDAVHQDQHITAQTTALPNTNPALTEPQPLGAFPDGFLFGGATAANQFEGAWNEDGKGP
SLQDVLPAGGLHPRTAEPTEDNLKLEGIDFYHRYREDIALLAEMGFKVFRFSIAWSRIFP
RGDEETPNEAGLAFYDRVLDELEKHGMEPLITLSHYETPLHLVEQYNGWTSRELIGFYER
YARTVLARYGKRVKYWLTFNEINSMLHLPFMSGGINTPADQLSDADLYQAMHHELVASAR
ATAAARELAPGAQIGCMILAMPTYPLTPDPADVLAAMQAEQANFAFGDVHVRGAYPGYFL
RALREKGVELNITEQDREDLKNTVDFVSFSYYMSTCATGDPARGERGEGNILGGVANPTL
PASEWGWQIDPTGLHVVLNQYWDRWQKPLFIVENGLGARDELVEVNGELTVEDDYRIDYL
RQHLHAVREAIEDGVNVLGYTTWGCIDMISASTAQMSKRYGFIYVDRNDDGTGTLARYRK
KSFHWYREVIASNGAKL
NT seq 1494 nt NT seq  +upstreamnt  +downstreamnt
ttggaggatgccgtgcatcaggaccagcacatcaccgcccaaaccaccgcgctacccaac
accaaccctgcgctgaccgagccgcagccgctcggcgcgttccccgacggtttcctcttc
ggaggcgccaccgccgccaaccagttcgaaggcgcctggaacgaagacggcaagggcccc
agcctgcaggatgtgctgcccgccggcggcctgcacccgcgcaccgccgaacccaccgag
gacaacctcaagctggaaggcatcgacttctaccaccgctaccgcgaagacatcgccctg
ctcgcggagatgggcttcaaggtcttccgcttctccatcgcctggtcgcgtatcttcccc
cgcggcgacgaagaaaccccgaacgaggcaggcctcgccttctacgaccgcgtgctcgac
gagctcgaaaagcacggcatggaaccgctcatcaccctcagccactacgaaaccccgttg
cacctggtcgagcagtacaatggctggaccagccgcgaactcatcggcttctacgaacgc
tacgcccgcaccgtgttagcccgctacggcaagcgcgtgaagtactggctgaccttcaac
gaaatcaactccatgctgcacctgccgttcatgtccggcggcatcaacaccccggcggat
cagctcagcgacgcggacctgtaccaggcgatgcaccacgagctggtcgcctccgcacgc
gccaccgccgcggcacgcgagctggcacccggcgcgcagatcggctgcatgattctagcc
atgcccacctacccgctcacccccgaccccgccgacgtcctcgccgcaatgcaggcggag
caggcgaacttcgcgttcggtgacgtgcacgtgcgcggcgcataccccggctacttcctg
cgtgccctgcgtgagaagggcgtggagctgaacatcaccgagcaggaccgcgaagacctg
aaaaacaccgtggatttcgtgtcgttcagctactacatgtccacctgcgcgaccggcgac
ccggcacggggcgaacgcggcgaaggcaatatcctcggcggcgtggcgaacccgaccctg
cccgccagcgaatggggttggcagatcgacccgaccggtctgcacgtggttctcaaccag
tattgggaccgctggcagaagccgctgttcatcgtggagaacggcctgggtgcccgtgac
gaactggtcgaggtgaacggtgagctcaccgtggaagacgactaccgcatcgactacctg
cgccagcacctgcacgcggtgcgcgaggcgattgaggacggcgtgaacgtgctcggctac
accacctggggttgcatcgacatgattagcgcctccaccgcgcagatgtccaagcgctac
gggttcatctacgtggaccgcaacgacgacggcaccggcaccctggcgcgctaccgcaag
aagtccttccactggtaccgcgaggtgattgccagcaacggcgcgaagctgtag

DBGET integrated database retrieval system