KEGG   Rothia mucilaginosa: RMDY18_09880Help
Entry
RMDY18_09880      CDS       T01144                                 

Definition
aspartate carbamoyltransferase, catalytic chain
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
rmu  Rothia mucilaginosa
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rmu00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    RMDY18_09880
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    RMDY18_09880
Enzymes [BR:rmu01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     RMDY18_09880
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1085336..1086337
Genome map
AA seq 333 aa AA seqDB search
MKHLLDTRELTREEAIEILDVADYMAQVKAENRTLNVLNGKTVVNLFFEDSTRTRLSFEA
AEKRLGAAVTNFSASGSSVSKGESLKDTAQTLKAIAADAFVIRHSASGAPQRLAEAGWTD
IPVLNAGDGTHAHPTQALLDAVSLRQYKAERDGLDSPRGTDLSGMRVLIVGDILHSRVAR
SNLWLLHTLGAQVVFVAPPTLLPLNTASWVEEAGLEIFHDFDEAIATKPDAVMLLRIQKE
RMRAAYFPSAEEYTELWGLTAERFATLQAQPQPVAILHPGPMNRGLEICTDAADAANSWV
LRQVSNGVALRMAVLYLLLTDGSSAKLYAGDES
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
atgaagcatctgctcgacacccgcgaactaacccgcgaagaagccatcgaaatccttgac
gtcgccgactacatggcgcaggtcaaagccgaaaaccgcaccctgaacgtgctcaacggc
aagaccgtcgtcaacctcttcttcgaggactccacccgaacccgcctctccttcgaagcc
gcagagaagcgcctgggcgccgccgtcaccaacttctccgcatctggctcctccgtctct
aagggcgagtcgctcaaggacaccgcgcagacccttaaggcgattgccgcggatgcgttc
gtgatccgccactcggcatccggcgcaccgcagcgcctcgccgaggcaggctggaccgac
atccccgtactcaacgcgggcgacggcacccacgcacaccccacccaggcactgctcgac
gccgtatccctgcgccagtacaaggcagaacgcgacggcctcgacagcccccgcggcacc
gacctgtccggtatgcgcgtgctcatcgtcggcgacatcctgcactcgcgcgtggcacgc
tccaacctctggctgctgcacaccctcggcgcgcaggtcgtcttcgtcgcaccgccgacc
ctgctgccgctgaacaccgcctcctgggttgaagaagccggcctggaaatcttccacgac
ttcgacgaagccatcgccaccaagcccgacgccgtgatgctgctgcgcatccagaaggaa
cgcatgcgcgccgcgtacttcccctccgccgaggagtacaccgagctgtggggcctgacc
gccgaacgcttcgcaaccctgcaggcacagccgcagccggtcgcaatcctgcacccgggc
cccatgaaccgcggcctggaaatctgcaccgacgccgccgacgccgccaactcctgggtt
ctgcgccaggtcagcaacggcgtggcgctgcgcatggcggtgctctacctgcttctgacc
gacggatccagcgccaagctctacgccggcgacgaatcctaa

DBGET integrated database retrieval system