KEGG   Rothia mucilaginosa: RMDY18_09980Help
Entry
RMDY18_09980      CDS       T01144                                 

Definition
guanylate kinase
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
rmu  Rothia mucilaginosa
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:rmu00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    RMDY18_09980
Enzymes [BR:rmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     RMDY18_09980
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1094766..1095323
Genome map
AA seq 185 aa AA seqDB search
MSQPTLTVLAGPTAVGKGTVCQYIRENYPNVWFSVSATTRDPRPGEVDGTHYYFVSMEEF
DQMIADGQMLEYAVVHGKNKYGTPRAKVQEALDAGRPVILEIDLQGARQIRETMPDARLI
FLAPPSWDELVSRLVGRGTESEQEQARRLETAKVELAAEKEFDVTVVNDTVERAAKEIAE
LIGAA
NT seq 558 nt NT seq  +upstreamnt  +downstreamnt
atgtctcagccgactctcaccgtactggctggccccactgctgttggcaagggtacggtg
tgccagtatattcgtgagaactacccgaacgtgtggttctctgtttccgctactactcgt
gatcctcgccccggtgaggttgacggtactcactactatttcgtttcgatggaagagttt
gaccagatgatcgctgacggtcagatgcttgagtacgctgtggtacacggtaagaacaag
tacggtactccgcgcgctaaggtccaggaggctctggacgctggtcgcccggtgatcctt
gagattgacttgcagggtgctcgccagattcgcgagaccatgcctgatgctcgcctgatt
ttcttggctcctccgagctgggatgagctggtgtcgcgtctggtcggtcgaggtaccgag
agtgagcaggagcaagctcgtcgccttgaaaccgcgaaggttgagctggctgctgagaag
gaatttgacgtcacggtcgtcaacgacactgttgagcgtgcagcgaaggagattgctgag
ctgattggcgccgcctaa

DBGET integrated database retrieval system