KEGG   Rothia mucilaginosa: RMDY18_11070Help
Entry
RMDY18_11070      CDS       T01144                                 

Definition
(GenBank) triosephosphate isomerase
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
rmu  Rothia mucilaginosa
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:rmu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    RMDY18_11070
   01230 Biosynthesis of amino acids
    RMDY18_11070
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RMDY18_11070
   00051 Fructose and mannose metabolism
    RMDY18_11070
   00562 Inositol phosphate metabolism
    RMDY18_11070
Enzymes [BR:rmu01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     RMDY18_11070
Exosome [BR:rmu04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   RMDY18_11070
  Exosomal proteins of bladder cancer cells
   RMDY18_11070
  Exosomal proteins of melanoma cells
   RMDY18_11070
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(1213296..1214072)
Genome map
AA seq 258 aa AA seqDB search
MSRKPLIAGNWKMNLNHAEAVTLVQKLAWTLDDANFNFSATEVAVFPPFTDIRSVQTLVE
GDKLDILYGGQDLSVHDSGAYTGEISGAFLSKLGATFVLVGHSERRTYHHESDELCAAKV
QAAYKHGLTPVLCVGEPLEIREAGTHVEYTLEQLRGSIAGLTAEQAETLVIAYEPVWAIG
TGKVATADDAQEMSAAIRAEIAKLYSADVAEKVRVLYGGSVKSSSAPSIMGKEDVDGVLV
GGASLQADEFAAIARFDA
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcgtaagcccctcatcgcaggcaactggaagatgaacctcaaccacgcagaggca
gtcaccctcgtccagaagctcgcatggaccctcgacgacgcaaacttcaacttctccgca
accgaagtagccgtcttcccgcccttcaccgacatccgctccgtgcagaccctcgtcgaa
ggcgacaagctggacatcctctacggcggccaggacctctccgtccacgactccggcgca
tacaccggcgaaatctccggcgcattcctctccaagctcggcgcaaccttcgtgctcgtc
ggccactccgagcgccgcacctaccaccacgaaagcgacgagctgtgcgcagcaaaggtt
caggcagcatacaagcacggcctgacccccgtcctctgcgtcggtgagcccctcgaaatc
cgcgaagcaggcacccacgtcgagtacaccctcgagcagctgcgcggctccatcgcaggt
ctgaccgcagagcaggcagaaaccctcgtcatcgcatacgagcccgtctgggcaatcggc
accggcaaggtcgcaaccgcagacgacgcacaggaaatgtccgcagcaatccgcgcagaa
atcgctaagctctactccgcagacgttgcagagaaggtccgcgttctctacggcggctcc
gtcaagtcctcctccgcaccctccatcatgggcaaggaagacgtggacggcgtgctcgtc
ggcggcgcatccctgcaggctgacgaattcgcagcaatcgcacgcttcgacgcataa

DBGET integrated database retrieval system