KEGG   Rothia mucilaginosa: RMDY18_12720Help
Entry
RMDY18_12720      CDS       T01144                                 

Definition
amidase
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
rmu  Rothia mucilaginosa
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Nicotinate and nicotinamide metabolism [PATH:rmu00760]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1433385..1434011
Genome map
AA seq 208 aa AA seqDB search
MSKALIIVDVQNDFCAGGALATERGADVAALISEYVENNHHRYDAIVATQDWHIEPGSHF
SDTPDYVDSWPVHCVAKSEGAQIHENLDTDYIEAYFRKGRFEAAYSGFEGLLAPEDEVAT
GEHEPGVDASEDGPQTPLSEWLDERGIEFVDVVGIATDYCVAATARDAVDAGYETRVLLD
LTAPVHEDKLDDVVAELEGEGVEVVEVL
NT seq 627 nt NT seq  +upstreamnt  +downstreamnt
atgtctaaggcactgattattgttgacgtgcagaacgatttctgcgccggcggcgccctc
gccaccgagcgcggtgcggacgttgccgcgctgattagcgaatatgtggagaacaaccac
caccgctacgatgcgattgttgccacccaggactggcacatcgagccgggttcacacttc
tccgacacccccgactatgttgactcctggccggtgcactgcgtcgccaagagcgaaggc
gcgcagattcacgagaacctggacaccgactacattgaggcgtacttccgtaagggccgc
ttcgaggcagcgtactcgggttttgagggtcttctggcacccgaggatgaggtcgcaacc
ggcgagcacgagcccggtgtggatgcgtccgaggacggcccgcagactcctctgtcggag
tggctggatgagcgcggcatcgagttcgtcgatgttgttggtatcgccaccgattattgc
gtggcggcaaccgctcgcgatgcggtcgatgcaggctacgagactcgcgtgctgcttgac
ctgaccgcgcccgtgcacgaggacaagcttgacgacgtggttgccgagcttgaaggtgag
ggcgttgaggtggttgaggttctctag

DBGET integrated database retrieval system