KEGG   Rothia mucilaginosa: RMDY18_13070Help
Entry
RMDY18_13070      CDS       T01144                                 

Definition
(RefSeq) threonine synthase
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
rmu  Rothia mucilaginosa
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:rmu00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    RMDY18_13070
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    RMDY18_13070
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    RMDY18_13070
Enzymes [BR:rmu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     RMDY18_13070
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1469570..1470685)
Genome map
AA seq 371 aa AA seqDB search
MKEKPMAHVWQGVINEYRDRLPFADDVKAVTLGEGGTPLIHAPALSAETGNTVYLKFEGM
NPTGSFKDRGMTSAMTAAKRDGAKAVVCASTGNTSASAAAYALQAGMRCAVLVPDGKISM
GKLSQAIAHGADIIQIDGNFDNCLEIARKLSENYPVFLVNSVNPYRIEGQKTGSFEVVDT
LGDAPDYHLLPVGNAGNITAYWKGYKEYSEPYTNRDGKVLEPVATKRPIMWGFQAAGAAP
IVAGHPIEAPETIATAIRIGNPASWEKAEAARDESGGVIEAVTDEEILEAHRWLSAREGV
FVEPASAAGVAGLLKKHRAGEAPEGKTIVITVTGHGLKDPQWALEAVNGVKVEPTKAPFD
VVAVADILDLN
NT seq 1116 nt NT seq  +upstreamnt  +downstreamnt
ttgaaggagaagccaatggcacacgtgtggcagggcgttatcaatgagtaccgtgaccgt
ctgcccttcgcagacgatgtgaaggctgtgaccctgggcgagggcggtaccccgctgatt
cacgcgccggcactgtctgctgagaccggtaacaccgtttacctgaagtttgagggtatg
aacccgaccggttcgttcaaggaccgcggtatgaccagcgcgatgaccgccgctaagcgt
gacggtgcgaaggctgttgtgtgtgcttcgaccggtaacacttctgcgtcggctgctgcg
tacgctctgcaggctggtatgcgctgtgcagtgctggttccggacggcaagatttctatg
ggtaagctgtctcaggctattgctcacggtgctgacatcattcagattgacggcaacttc
gataactgcctggagattgctcgcaagctcagcgagaactacccggtgttcctggtgaac
tcggtgaacccttaccgtattgagggtcagaagaccggttcgttcgaggttgttgacacc
ctgggtgacgctcccgattaccacctgctgccggtgggcaacgcgggtaacattaccgcg
tactggaagggctacaaggagtactcggagccttacaccaaccgtgacggtaaggttctg
gagccggttgcgaccaagcgtccgatcatgtggggcttccaggctgctggtgctgctccg
attgttgctggccacccgattgaggctcctgagaccattgcaaccgctatccgtatcggt
aaccccgcgtcgtgggagaaggctgaggctgctcgtgacgagtccggcggcgtgattgag
gctgtcaccgatgaggagattctggaggcgcaccgctggctgtctgcccgcgagggtgtc
ttcgtggagccggcttcggctgctggcgttgcgggtctgctgaagaagcaccgtgccggt
gaagctcccgagggtaagaccatcgtcatcaccgtgaccggtcacggtctgaaggacccg
cagtgggctcttgaggctgttaacggtgtgaaggttgagccgactaaggctcccttcgac
gtggttgctgtggcagatattcttgatttgaactag

DBGET integrated database retrieval system